BLASTX nr result
ID: Ophiopogon22_contig00035075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035075 (628 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009404603.1| PREDICTED: putative wall-associated receptor... 48 3e-06 >ref|XP_009404603.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Musa acuminata subsp. malaccensis] Length = 737 Score = 48.1 bits (113), Expect(2) = 3e-06 Identities = 26/48 (54%), Positives = 35/48 (72%), Gaps = 2/48 (4%) Frame = +3 Query: 9 EQNLTQCFRLNMM-DHLFETLEPRMRNGGSRDQQLAIASVT-KCLRMR 146 EQNL F ++M D LFE LEPR+RN G+R+Q L +A +T +CLR+R Sbjct: 622 EQNLAIYFLVHMREDRLFEILEPRVRNEGNREQLLTVAELTRRCLRLR 669 Score = 31.2 bits (69), Expect(2) = 3e-06 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +2 Query: 146 ERPAINEVAIELQRLRRQEDQP 211 ERP + EVA EL+R RRQ + P Sbjct: 672 ERPTMTEVAAELERTRRQREHP 693