BLASTX nr result
ID: Ophiopogon22_contig00034681
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00034681 (486 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PBG05472.1| hypothetical protein BGU80_19190, partial [Clostr... 59 1e-07 ref|XP_011557173.1| PREDICTED: probable splicing factor, arginin... 59 4e-07 gb|KXH54105.1| hypothetical protein CSAL01_10484 [Colletotrichum... 57 2e-06 gb|PBG04093.1| hypothetical protein BGU80_19315, partial [Clostr... 54 5e-06 >gb|PBG05472.1| hypothetical protein BGU80_19190, partial [Clostridioides difficile] Length = 168 Score = 58.5 bits (140), Expect = 1e-07 Identities = 38/122 (31%), Positives = 62/122 (50%), Gaps = 4/122 (3%) Frame = +1 Query: 103 QTQRQKRHQKRSTKVYKRDRKKNHSD*PISKLKKGKKERNLGEGVEKLEKKPK--ISRRK 276 + +++K+ +KR K KR++KK + I K KK KKE+ E E EKK K RRK Sbjct: 15 EKRKRKKGEKRKKKEKKREKKKKKKEEKIKKKKKEKKEKRKEEEKENKEKKKKKRKERRK 74 Query: 277 TYLNRNRADSQGPTPTKHQITTEKVQKNLPRD--HQERSPKRTKGRERMPEENAQRNRTR 450 R + + K + +K ++ ++ +ER K +GRER +E ++ R + Sbjct: 75 RKEERRKKKREKKKERKREKKKKKKERKKKKEKRKKERKKKEKEGRERGEKEKGKKKRKK 134 Query: 451 KR 456 KR Sbjct: 135 KR 136 >ref|XP_011557173.1| PREDICTED: probable splicing factor, arginine/serine-rich 7 isoform X2 [Plutella xylostella] Length = 584 Score = 58.9 bits (141), Expect = 4e-07 Identities = 45/162 (27%), Positives = 80/162 (49%), Gaps = 12/162 (7%) Frame = +1 Query: 7 NRIQKNNFHSKQSTKRSSHRS------TIHSQ*ATNGSQTQRQKRHQKRS---TKVYKRD 159 +R ++ SK+S RS HRS + H + + S+ + +R + RS + KRD Sbjct: 302 SRRSRSRHRSKRSRSRSRHRSRRSRSRSRHRHRSRSRSRHRSSRRSRSRSRHRSSRSKRD 361 Query: 160 RKKNHSD--*PISKLKKGKKERNLGEGVEKLEKKPKISRRKTYLNRNRADSQGPTPTKH- 330 R ++ D P+ K KK K + E +EK EK+ KI T A S+ +P + Sbjct: 362 RSRDRKDKKEPLDKDKKEKSKSPTKESIEKDEKEMKIDAETTEAPEVEAKSKASSPVEDG 421 Query: 331 QITTEKVQKNLPRDHQERSPKRTKGRERMPEENAQRNRTRKR 456 ++ E +K+ + + RS ++++ R+R R+R+RK+ Sbjct: 422 KVDAESKEKSPVKKDRSRSREKSRKRDRSRSRRRSRSRSRKK 463 >gb|KXH54105.1| hypothetical protein CSAL01_10484 [Colletotrichum salicis] Length = 814 Score = 57.0 bits (136), Expect = 2e-06 Identities = 39/173 (22%), Positives = 81/173 (46%), Gaps = 12/173 (6%) Frame = +1 Query: 1 PTNRIQKNNFHSKQSTKRSSHRSTIHSQ*ATNGSQTQRQKRHQ--KRSTKVYKRDRKKNH 174 P +R + S+ T+R RS + S+T+ + RH + T+ +RDR ++ Sbjct: 444 PRDRSRDRRDRSRSRTRRDRSRSRRPERRERTPSRTRSKTRHDHSRSRTRHDRRDRSRSR 503 Query: 175 SD*PISKLKKGKKERNLGEGVEKLEKKPKISRRKTYLNRNRADSQGPTPTKHQITTEK-- 348 S +++ +++R+ E+ + + RR +R RAD + + ++ + TE+ Sbjct: 504 SRDRRDRIRTDRRDRSRSRRRERSRSRVRNDRRDRSRSRVRADRRDKSRSRSRTRTERRD 563 Query: 349 --------VQKNLPRDHQERSPKRTKGRERMPEENAQRNRTRKRLPFQLVESS 483 ++++ RD P+R + +R P E +++R+R R P V S+ Sbjct: 564 RSRSPRPDRRESIRRDRSRSRPRRDRSSDRKPSERDRKSRSRSRQPSPAVRST 616 >gb|PBG04093.1| hypothetical protein BGU80_19315, partial [Clostridioides difficile] Length = 151 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/121 (25%), Positives = 61/121 (50%) Frame = +1 Query: 94 NGSQTQRQKRHQKRSTKVYKRDRKKNHSD*PISKLKKGKKERNLGEGVEKLEKKPKISRR 273 NG + + ++ +K+ K KR +KK + K KK KKE+ + EK +KK K ++ Sbjct: 5 NGEEKEEKEEKEKKKKKKKKRKKKKRKKEKRKKKKKKKKKEKRKKKKKEKEKKKKKKKKK 64 Query: 274 KTYLNRNRADSQGPTPTKHQITTEKVQKNLPRDHQERSPKRTKGRERMPEENAQRNRTRK 453 K R + + K + E+ +K + ++R K+ KG+E+ +E ++ + +K Sbjct: 65 KKRKRRRKKKKKKKRKKKKK---EEKKKKKKKRKKKRKKKKKKGKEKKKKEEKEKKKKKK 121 Query: 454 R 456 + Sbjct: 122 K 122