BLASTX nr result
ID: Ophiopogon22_contig00033790
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00033790 (472 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274237.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 70 6e-11 ref|XP_019230361.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 58 7e-07 ref|XP_009803967.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 58 7e-07 ref|XP_004490301.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 58 7e-07 ref|XP_013443029.1| F-box/RNI/FBD-like domain protein [Medicago ... 57 1e-06 ref|XP_009596698.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 57 1e-06 ref|XP_013443028.1| F-box/RNI/FBD-like domain protein [Medicago ... 57 2e-06 ref|XP_013443030.1| F-box/RNI/FBD-like domain protein [Medicago ... 57 2e-06 dbj|GAU49559.1| hypothetical protein TSUD_242920 [Trifolium subt... 57 2e-06 ref|XP_024166870.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 57 2e-06 ref|XP_022149100.1| F-box/FBD/LRR-repeat protein At1g13570 [Momo... 57 2e-06 gb|AKQ06190.1| F-box/FBD/LRR-repeat protein [Momordica charantia] 57 2e-06 ref|XP_024166869.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 57 2e-06 ref|XP_013443027.1| F-box/RNI/FBD-like domain protein [Medicago ... 57 2e-06 ref|XP_022979919.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 57 2e-06 ref|XP_022957268.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 57 2e-06 ref|XP_008446506.1| PREDICTED: LOW QUALITY PROTEIN: F-box/FBD/LR... 57 2e-06 ref|XP_004135131.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 57 2e-06 gb|ONH91996.1| hypothetical protein PRUPE_8G148700 [Prunus persica] 56 3e-06 ref|XP_018631410.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 56 3e-06 >ref|XP_020274237.1| F-box/FBD/LRR-repeat protein At1g13570-like [Asparagus officinalis] gb|ONK79327.1| uncharacterized protein A4U43_C01F5240 [Asparagus officinalis] Length = 415 Score = 69.7 bits (169), Expect = 6e-11 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = +1 Query: 343 MDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 M++DL +++SSLPKNVIE IL+R+PIRDAVRTS+LSRGWR+E Sbjct: 1 MNSDLDTDRLSSLPKNVIETILMRMPIRDAVRTSILSRGWRFE 43 >ref|XP_019230361.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570 [Nicotiana attenuata] Length = 422 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +1 Query: 343 MDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 MD D G + IS LP+++IE IL++LP+ DAVRTS+LSR WRY+ Sbjct: 1 MDTDSGRDLISDLPQSIIETILIKLPLLDAVRTSVLSRKWRYK 43 >ref|XP_009803967.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570 [Nicotiana sylvestris] ref|XP_016489743.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana tabacum] Length = 422 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +1 Query: 343 MDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 MD D G + IS LP+++IE IL++LP+ DAVRTS+LSR WRY+ Sbjct: 1 MDTDSGRDLISDLPQSIIETILIKLPLLDAVRTSVLSRKWRYK 43 >ref|XP_004490301.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Cicer arietinum] Length = 422 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +1 Query: 355 LGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 +G++ IS LP+N+IE IL++LPIRDAVRTS+LSR WRY+ Sbjct: 5 MGSDLISDLPQNIIESILIQLPIRDAVRTSILSRKWRYK 43 >ref|XP_013443029.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] gb|KEH17054.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 276 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +1 Query: 343 MDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 MD G + IS LP+++IE IL++LPIRDAVRTS+LSR WRY+ Sbjct: 1 MDDFSGPDLISDLPQSIIETILIQLPIRDAVRTSILSRKWRYK 43 >ref|XP_009596698.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570 [Nicotiana tomentosiformis] ref|XP_016479267.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana tabacum] Length = 422 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +1 Query: 343 MDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 MD D G + IS LP++++E IL++LP+ DAVRTS+LSR WRY+ Sbjct: 1 MDTDSGRDLISDLPQSILETILIKLPLLDAVRTSVLSRKWRYK 43 >ref|XP_013443028.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] gb|KEH17053.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 338 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +1 Query: 343 MDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 MD G + IS LP+++IE IL++LPIRDAVRTS+LSR WRY+ Sbjct: 1 MDDFSGPDLISDLPQSIIETILIQLPIRDAVRTSILSRKWRYK 43 >ref|XP_013443030.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] gb|KEH17055.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 341 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +1 Query: 343 MDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 MD G + IS LP+++IE IL++LPIRDAVRTS+LSR WRY+ Sbjct: 1 MDDFSGPDLISDLPQSIIETILIQLPIRDAVRTSILSRKWRYK 43 >dbj|GAU49559.1| hypothetical protein TSUD_242920 [Trifolium subterraneum] Length = 403 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +1 Query: 343 MDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 MD G + IS LP+++IE IL++LPIRDAVRTS+LSR WRY+ Sbjct: 1 MDDFSGPDLISDLPQSIIETILIQLPIRDAVRTSILSRKWRYK 43 >ref|XP_024166870.1| F-box/FBD/LRR-repeat protein At1g13570-like isoform X2 [Rosa chinensis] ref|XP_024166871.1| F-box/FBD/LRR-repeat protein At1g13570-like isoform X2 [Rosa chinensis] Length = 418 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +1 Query: 340 QMDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRY 468 ++ D+G +K S+LP +VIE ILL LPIRDAVRTS+LS WRY Sbjct: 9 RLKMDMGLDKFSNLPSDVIEKILLLLPIRDAVRTSVLSNKWRY 51 >ref|XP_022149100.1| F-box/FBD/LRR-repeat protein At1g13570 [Momordica charantia] ref|XP_022149101.1| F-box/FBD/LRR-repeat protein At1g13570 [Momordica charantia] Length = 418 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +1 Query: 343 MDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 MD LG + +S LP+++IE IL RLPIRDA+RTS+LSR WR++ Sbjct: 1 MDDLLGVDHLSDLPQSIIECILTRLPIRDAIRTSILSRRWRFK 43 >gb|AKQ06190.1| F-box/FBD/LRR-repeat protein [Momordica charantia] Length = 418 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +1 Query: 343 MDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 MD LG + +S LP+++IE IL RLPIRDA+RTS+LSR WR++ Sbjct: 1 MDDLLGVDHLSDLPQSIIECILTRLPIRDAIRTSILSRRWRFK 43 >ref|XP_024166869.1| F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Rosa chinensis] gb|PRQ23960.1| putative F-box domain, FBD domain, leucine-rich repeat domain, L domain-containing protein [Rosa chinensis] Length = 419 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +1 Query: 340 QMDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRY 468 ++ D+G +K S+LP +VIE ILL LPIRDAVRTS+LS WRY Sbjct: 10 RLKMDMGLDKFSNLPSDVIEKILLLLPIRDAVRTSVLSNKWRY 52 >ref|XP_013443027.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] gb|KEH17052.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 421 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +1 Query: 343 MDADLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 MD G + IS LP+++IE IL++LPIRDAVRTS+LSR WRY+ Sbjct: 1 MDDFSGPDLISDLPQSIIETILIQLPIRDAVRTSILSRKWRYK 43 >ref|XP_022979919.1| F-box/FBD/LRR-repeat protein At1g13570-like [Cucurbita maxima] Length = 418 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +1 Query: 355 LGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 LG + +S LP+++IE IL RLPIRDA+RTS+LSR WRY+ Sbjct: 5 LGVDHLSDLPQSIIECILTRLPIRDAIRTSVLSRRWRYK 43 >ref|XP_022957268.1| F-box/FBD/LRR-repeat protein At1g13570-like [Cucurbita moschata] Length = 418 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +1 Query: 355 LGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 LG + +S LP+++IE IL RLPIRDA+RTS+LSR WRY+ Sbjct: 5 LGVDHLSDLPQSIIECILTRLPIRDAIRTSVLSRRWRYK 43 >ref|XP_008446506.1| PREDICTED: LOW QUALITY PROTEIN: F-box/FBD/LRR-repeat protein At1g13570-like [Cucumis melo] Length = 418 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +1 Query: 355 LGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 LG + +S LP+++IE IL RLPIRDA+RTS+LSR WRY+ Sbjct: 5 LGVDHLSDLPQSIIECILTRLPIRDAIRTSILSRRWRYK 43 >ref|XP_004135131.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570 [Cucumis sativus] gb|KGN52016.1| hypothetical protein Csa_5G608040 [Cucumis sativus] Length = 418 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +1 Query: 355 LGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 LG + +S LP+++IE IL RLPIRDA+RTS+LSR WRY+ Sbjct: 5 LGVDHLSDLPQSIIECILTRLPIRDAIRTSILSRRWRYK 43 >gb|ONH91996.1| hypothetical protein PRUPE_8G148700 [Prunus persica] Length = 344 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +1 Query: 352 DLGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRYE 471 ++ +KIS+LP +VIE ILL LPIRDAVRTS+LSR WRY+ Sbjct: 19 EIKTDKISNLPSDVIEKILLLLPIRDAVRTSVLSRKWRYK 58 >ref|XP_018631410.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X3 [Nicotiana tomentosiformis] Length = 399 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 355 LGANKISSLPKNVIEVILLRLPIRDAVRTSMLSRGWRY 468 LG + IS+LP NVI+VIL+RLP +DAVRTS+LS+ WRY Sbjct: 13 LGPDVISNLPDNVIDVILMRLPCKDAVRTSILSKKWRY 50