BLASTX nr result
ID: Ophiopogon22_contig00033782
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00033782 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK77007.1| uncharacterized protein A4U43_C02F2150 [Asparagus... 65 3e-09 >gb|ONK77007.1| uncharacterized protein A4U43_C02F2150 [Asparagus officinalis] Length = 1107 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 125 AAEVGAEAVQLGDRSFSMPIELYDLKDLSFVLSVRNWNELL 3 AAE G E VQ GD+SF +PIELYDLKDLS +LSV +WNELL Sbjct: 22 AAEAGTELVQFGDQSFCVPIELYDLKDLSLILSVSSWNELL 62