BLASTX nr result
ID: Ophiopogon22_contig00033613
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00033613 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIA65666.1| hypothetical protein AQUCO_00100875v1 [Aquilegia ... 53 4e-06 ref|XP_006596183.1| PREDICTED: exosome complex component RRP43-l... 54 8e-06 >gb|PIA65666.1| hypothetical protein AQUCO_00100875v1 [Aquilegia coerulea] Length = 143 Score = 52.8 bits (125), Expect = 4e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = +3 Query: 237 ICILMQDIYCLNADGSLFDAALLSAIAAFSH 329 + ++QD+YCLNADG++FDAALLSA++AFSH Sbjct: 4 LTFVLQDVYCLNADGAIFDAALLSAVSAFSH 34 >ref|XP_006596183.1| PREDICTED: exosome complex component RRP43-like isoform X1 [Glycine max] ref|XP_006596184.1| PREDICTED: exosome complex component RRP43-like isoform X1 [Glycine max] gb|KRH16280.1| hypothetical protein GLYMA_14G145600 [Glycine max] Length = 307 Score = 53.5 bits (127), Expect = 8e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +3 Query: 219 LMYLRLICILMQDIYCLNADGSLFDAALLSAIAAFSH 329 + YL +MQDIYCL+ADG+LFDAAL+SA+AA SH Sbjct: 148 MAYLNAAFSIMQDIYCLDADGALFDAALISAVAALSH 184