BLASTX nr result
ID: Ophiopogon22_contig00033347
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00033347 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAY54979.1| hypothetical protein CUMW_160900 [Citrus unshiu] 70 5e-12 gb|PIA24961.1| hypothetical protein AQUCO_13600003v1 [Aquilegia ... 71 1e-11 ref|NP_001168032.1| uncharacterized protein LOC100381759 [Zea ma... 67 1e-11 gb|EPS62481.1| trehalose-6-phosphate synthase, partial [Genlisea... 69 2e-11 ref|XP_020579961.1| alpha,alpha-trehalose-phosphate synthase [UD... 69 4e-11 ref|XP_020266273.1| alpha,alpha-trehalose-phosphate synthase [UD... 69 5e-11 gb|ONK81973.1| uncharacterized protein A4U43_C01F34810 [Asparagu... 69 5e-11 gb|KMZ65155.1| Trehalose-6-phosphate synthase [Zostera marina] 69 5e-11 gb|KMZ65449.1| Trehalose-6-phosphate synthase [Zostera marina] 69 5e-11 ref|XP_010062772.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 69 5e-11 ref|XP_019710093.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 69 5e-11 ref|XP_020581584.1| alpha,alpha-trehalose-phosphate synthase [UD... 69 5e-11 ref|XP_009406159.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 69 5e-11 ref|XP_020676462.1| alpha,alpha-trehalose-phosphate synthase [UD... 69 5e-11 ref|XP_019706902.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 69 5e-11 ref|XP_019706901.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 69 5e-11 ref|XP_018674217.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 69 5e-11 ref|XP_010924683.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 69 5e-11 gb|ABF70084.1| trehalose-6-phosphate synthase, putative [Musa ba... 69 5e-11 ref|XP_010916228.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 69 5e-11 >dbj|GAY54979.1| hypothetical protein CUMW_160900 [Citrus unshiu] Length = 215 Score = 69.7 bits (169), Expect = 5e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 253 FQHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 FQHVFEYFTERTPRSHFE RETSLVWNYKYA Sbjct: 5 FQHVFEYFTERTPRSHFEQRETSLVWNYKYA 35 >gb|PIA24961.1| hypothetical protein AQUCO_13600003v1 [Aquilegia coerulea] Length = 944 Score = 70.9 bits (172), Expect = 1e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 256 NFQHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 NFQHVFEYFTERTPRSHFE RETSLVWNYKYA Sbjct: 704 NFQHVFEYFTERTPRSHFELRETSLVWNYKYA 735 >ref|NP_001168032.1| uncharacterized protein LOC100381759 [Zea mays] gb|ACN26887.1| unknown [Zea mays] Length = 156 Score = 67.4 bits (163), Expect = 1e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETS VWNYKYA Sbjct: 78 KHVFEYFTERTPRSHFEHRETSFVWNYKYA 107 >gb|EPS62481.1| trehalose-6-phosphate synthase, partial [Genlisea aurea] Length = 278 Score = 68.9 bits (167), Expect = 2e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 41 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 70 >ref|XP_020579961.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Phalaenopsis equestris] Length = 484 Score = 68.9 bits (167), Expect = 4e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 210 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 239 >ref|XP_020266273.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Asparagus officinalis] Length = 834 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 578 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 607 >gb|ONK81973.1| uncharacterized protein A4U43_C01F34810 [Asparagus officinalis] Length = 889 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 633 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 662 >gb|KMZ65155.1| Trehalose-6-phosphate synthase [Zostera marina] Length = 894 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 654 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 683 >gb|KMZ65449.1| Trehalose-6-phosphate synthase [Zostera marina] Length = 924 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 685 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 714 >ref|XP_010062772.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Eucalyptus grandis] ref|XP_010062773.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Eucalyptus grandis] ref|XP_010062774.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Eucalyptus grandis] ref|XP_010062775.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Eucalyptus grandis] ref|XP_010062776.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Eucalyptus grandis] gb|KCW69903.1| hypothetical protein EUGRSUZ_F03232 [Eucalyptus grandis] Length = 925 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 689 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 718 >ref|XP_019710093.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X2 [Elaeis guineensis] Length = 941 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 708 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 737 >ref|XP_020581584.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Phalaenopsis equestris] ref|XP_020581585.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Phalaenopsis equestris] ref|XP_020581586.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Phalaenopsis equestris] ref|XP_020581587.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Phalaenopsis equestris] Length = 950 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 694 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 723 >ref|XP_009406159.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Musa acuminata subsp. malaccensis] ref|XP_018683575.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Musa acuminata subsp. malaccensis] Length = 954 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 708 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 737 >ref|XP_020676462.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Dendrobium catenatum] ref|XP_020676463.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Dendrobium catenatum] ref|XP_020676465.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Dendrobium catenatum] ref|XP_020676466.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Dendrobium catenatum] gb|PKU80677.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Dendrobium catenatum] Length = 955 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 697 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 726 >ref|XP_019706902.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X3 [Elaeis guineensis] Length = 958 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 692 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 721 >ref|XP_019706901.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X2 [Elaeis guineensis] Length = 959 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 700 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 729 >ref|XP_018674217.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Musa acuminata subsp. malaccensis] ref|XP_018674218.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Musa acuminata subsp. malaccensis] ref|XP_018674220.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Musa acuminata subsp. malaccensis] ref|XP_018674221.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Musa acuminata subsp. malaccensis] ref|XP_018674222.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Musa acuminata subsp. malaccensis] Length = 960 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 709 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 738 >ref|XP_010924683.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] ref|XP_010924684.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] ref|XP_010924685.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] ref|XP_010924686.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] ref|XP_010924687.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] ref|XP_010924688.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] ref|XP_010924689.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] Length = 966 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 700 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 729 >gb|ABF70084.1| trehalose-6-phosphate synthase, putative [Musa balbisiana] Length = 969 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 723 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 752 >ref|XP_010916228.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] ref|XP_010916237.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] ref|XP_010916246.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] ref|XP_019710077.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] ref|XP_019710081.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] ref|XP_019710086.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X1 [Elaeis guineensis] Length = 974 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 250 QHVFEYFTERTPRSHFEHRETSLVWNYKYA 161 +HVFEYFTERTPRSHFEHRETSLVWNYKYA Sbjct: 708 KHVFEYFTERTPRSHFEHRETSLVWNYKYA 737