BLASTX nr result
ID: Ophiopogon22_contig00033250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00033250 (644 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY40526.1| hypothetical protein RhiirA4_494351 [Rhizophagus ... 83 5e-15 >gb|PKY40526.1| hypothetical protein RhiirA4_494351 [Rhizophagus irregularis] Length = 397 Score = 83.2 bits (204), Expect = 5e-15 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = +2 Query: 242 EPSGELAACQAAFILPCLLRQVRCSIIKAKYAPLTDSAEYREGRLKKQ 385 E ELAACQAAFI+PCLLRQ RC+IIKAKY PLTDSAEYREG LKKQ Sbjct: 282 ESRRELAACQAAFIIPCLLRQERCTIIKAKYVPLTDSAEYREGMLKKQ 329