BLASTX nr result
ID: Ophiopogon22_contig00033173
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00033173 (596 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX92527.1| hypothetical protein L195_g015665 [Trifolium prat... 60 3e-09 gb|PNX90001.1| 1-aminocyclopropane-1-carboxylate oxidase-like pr... 60 3e-09 gb|PNX98414.1| hypothetical protein L195_g021661 [Trifolium prat... 60 3e-09 gb|AGC78850.1| hypothetical protein (mitochondrion) [Vicia faba] 60 1e-08 >gb|PNX92527.1| hypothetical protein L195_g015665 [Trifolium pratense] Length = 287 Score = 60.1 bits (144), Expect(2) = 3e-09 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 550 FFFGPFRPVVRTSSFHVEDTGSIPVRDRYVIP 455 + FGPFRPVVRTSSFHVEDTGSIPVRD Y P Sbjct: 252 WLFGPFRPVVRTSSFHVEDTGSIPVRDGYSFP 283 Score = 29.3 bits (64), Expect(2) = 3e-09 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 596 KQTTSILGAEVYEE 555 K+TTSILGAEVYEE Sbjct: 238 KRTTSILGAEVYEE 251 >gb|PNX90001.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Trifolium pratense] Length = 165 Score = 60.1 bits (144), Expect(2) = 3e-09 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 550 FFFGPFRPVVRTSSFHVEDTGSIPVRDRYVIP 455 + FGPFRPVVRTSSFHVEDTGSIPVRD Y P Sbjct: 130 WLFGPFRPVVRTSSFHVEDTGSIPVRDGYSFP 161 Score = 29.3 bits (64), Expect(2) = 3e-09 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 596 KQTTSILGAEVYEE 555 K+TTSILGAEVYEE Sbjct: 116 KRTTSILGAEVYEE 129 >gb|PNX98414.1| hypothetical protein L195_g021661 [Trifolium pratense] Length = 91 Score = 60.1 bits (144), Expect(2) = 3e-09 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 550 FFFGPFRPVVRTSSFHVEDTGSIPVRDRYVIP 455 + FGPFRPVVRTSSFHVEDTGSIPVRD Y P Sbjct: 56 WLFGPFRPVVRTSSFHVEDTGSIPVRDGYSFP 87 Score = 29.3 bits (64), Expect(2) = 3e-09 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 596 KQTTSILGAEVYEE 555 K+TTSILGAEVYEE Sbjct: 42 KRTTSILGAEVYEE 55 >gb|AGC78850.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 91 Score = 60.1 bits (144), Expect = 1e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 550 FFFGPFRPVVRTSSFHVEDTGSIPVRDRYVIP 455 + FGPFRPVVRTSSFHVEDTGSIPVRD Y P Sbjct: 56 WLFGPFRPVVRTSSFHVEDTGSIPVRDGYSFP 87