BLASTX nr result
ID: Ophiopogon22_contig00033132
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00033132 (598 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275026.1| uncharacterized protein LOC109849589 [Aspara... 69 2e-10 >ref|XP_020275026.1| uncharacterized protein LOC109849589 [Asparagus officinalis] gb|ONK64221.1| uncharacterized protein A4U43_C07F23390 [Asparagus officinalis] Length = 326 Score = 68.9 bits (167), Expect = 2e-10 Identities = 39/90 (43%), Positives = 53/90 (58%), Gaps = 15/90 (16%) Frame = +3 Query: 3 LFLVGSDIHRKGAWRSIAKNFVHTRT---------------LKRQRRRYGSVLDITTIPE 137 LFL+G +H +GAW+SIAKNFVHTRT L +++R S+LDI TI Sbjct: 184 LFLMGLKVHGRGAWKSIAKNFVHTRTPSQVASHAQKYFNRQLDERQKRRPSILDIKTINT 243 Query: 138 TIEPYQGIMCDSVDTNSQTQLNNANQYSSS 227 T + + M DS+ ++SQ LNNA + S S Sbjct: 244 TAKTRRESMYDSIKSSSQVNLNNAKRSSPS 273