BLASTX nr result
ID: Ophiopogon22_contig00033045
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00033045 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020277320.1| ent-kaur-16-ene synthase, chloroplastic isof... 80 1e-14 ref|XP_020277318.1| ent-kaur-16-ene synthase, chloroplastic isof... 80 1e-14 ref|XP_020277317.1| ent-kaur-16-ene synthase, chloroplastic isof... 80 1e-14 ref|XP_020194765.1| ent-kaur-16-ene synthase, chloroplastic-like... 72 1e-11 ref|XP_020194764.1| ent-kaur-16-ene synthase, chloroplastic-like... 72 1e-11 gb|EMS57625.1| Ent-kaur-16-ene synthase, chloroplastic [Triticum... 72 1e-11 ref|XP_010941701.1| PREDICTED: ent-kaur-16-ene synthase, chlorop... 72 1e-11 ref|XP_010941830.2| PREDICTED: ent-kaur-16-ene synthase, chlorop... 72 1e-11 ref|XP_020194763.1| ent-kaur-16-ene synthase, chloroplastic-like... 72 1e-11 emb|CBY78874.1| KS protein [Triticum urartu] 72 1e-11 gb|ADZ55290.1| ent-kaurene synthase [Triticum aestivum] 72 1e-11 ref|XP_020194762.1| ent-kaur-16-ene synthase, chloroplastic-like... 72 1e-11 ref|XP_020194761.1| ent-kaur-16-ene synthase, chloroplastic-like... 72 1e-11 emb|CBX87013.1| KS protein [Triticum aestivum] 72 1e-11 dbj|BAL41693.1| ent-kaurene synthase like 6 [Triticum aestivum] 72 1e-11 gb|OAY64804.1| Ent-kaur-16-ene synthase, chloroplastic, partial ... 72 1e-11 ref|XP_020103574.1| ent-kaur-16-ene synthase, chloroplastic-like... 71 2e-11 gb|PKA52242.1| Ent-kaur-16-ene synthase, chloroplastic [Apostasi... 70 2e-11 ref|XP_017701627.1| PREDICTED: ent-kaur-16-ene synthase, chlorop... 70 3e-11 ref|XP_017701626.1| PREDICTED: ent-kaur-16-ene synthase, chlorop... 70 3e-11 >ref|XP_020277320.1| ent-kaur-16-ene synthase, chloroplastic isoform X3 [Asparagus officinalis] Length = 757 Score = 80.5 bits (197), Expect = 1e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EGSVVP+DCKELFWKMSKVLHLFYLR DGFTSPKEM+AA Sbjct: 703 EGSVVPKDCKELFWKMSKVLHLFYLRNDGFTSPKEMVAA 741 >ref|XP_020277318.1| ent-kaur-16-ene synthase, chloroplastic isoform X2 [Asparagus officinalis] Length = 796 Score = 80.5 bits (197), Expect = 1e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EGSVVP+DCKELFWKMSKVLHLFYLR DGFTSPKEM+AA Sbjct: 742 EGSVVPKDCKELFWKMSKVLHLFYLRNDGFTSPKEMVAA 780 >ref|XP_020277317.1| ent-kaur-16-ene synthase, chloroplastic isoform X1 [Asparagus officinalis] gb|ONK60811.1| uncharacterized protein A4U43_C08F22910 [Asparagus officinalis] Length = 799 Score = 80.5 bits (197), Expect = 1e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EGSVVP+DCKELFWKMSKVLHLFYLR DGFTSPKEM+AA Sbjct: 745 EGSVVPKDCKELFWKMSKVLHLFYLRNDGFTSPKEMVAA 783 >ref|XP_020194765.1| ent-kaur-16-ene synthase, chloroplastic-like isoform X5 [Aegilops tauschii subsp. tauschii] Length = 592 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EG+VVPR CKELFWKM K+LHLFY RTDGF+SPKEM +A Sbjct: 541 EGTVVPRACKELFWKMCKILHLFYFRTDGFSSPKEMASA 579 >ref|XP_020194764.1| ent-kaur-16-ene synthase, chloroplastic-like isoform X4 [Aegilops tauschii subsp. tauschii] Length = 593 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EG+VVPR CKELFWKM K+LHLFY RTDGF+SPKEM +A Sbjct: 542 EGTVVPRACKELFWKMCKILHLFYFRTDGFSSPKEMASA 580 >gb|EMS57625.1| Ent-kaur-16-ene synthase, chloroplastic [Triticum urartu] Length = 793 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EG+VVPR CKELFWKM K+LHLFY RTDGF+SPKEM +A Sbjct: 742 EGTVVPRACKELFWKMCKILHLFYFRTDGFSSPKEMASA 780 >ref|XP_010941701.1| PREDICTED: ent-kaur-16-ene synthase, chloroplastic-like [Elaeis guineensis] ref|XP_019711188.1| PREDICTED: ent-kaur-16-ene synthase, chloroplastic-like [Elaeis guineensis] Length = 806 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EGSVVPR CKELFWKMS+VLHLFY++ DGFTSP EM++A Sbjct: 755 EGSVVPRACKELFWKMSRVLHLFYMKNDGFTSPTEMVSA 793 >ref|XP_010941830.2| PREDICTED: ent-kaur-16-ene synthase, chloroplastic-like [Elaeis guineensis] Length = 813 Score = 72.0 bits (175), Expect = 1e-11 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EGSVVPR CKELFWKMS++LHLFY++ DG+TSPKEM++A Sbjct: 756 EGSVVPRACKELFWKMSRMLHLFYIKNDGYTSPKEMVSA 794 >ref|XP_020194763.1| ent-kaur-16-ene synthase, chloroplastic-like isoform X3 [Aegilops tauschii subsp. tauschii] Length = 846 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EG+VVPR CKELFWKM K+LHLFY RTDGF+SPKEM +A Sbjct: 795 EGTVVPRACKELFWKMCKILHLFYFRTDGFSSPKEMASA 833 >emb|CBY78874.1| KS protein [Triticum urartu] Length = 846 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EG+VVPR CKELFWKM K+LHLFY RTDGF+SPKEM +A Sbjct: 795 EGTVVPRACKELFWKMCKILHLFYFRTDGFSSPKEMASA 833 >gb|ADZ55290.1| ent-kaurene synthase [Triticum aestivum] Length = 846 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EG+VVPR CKELFWKM K+LHLFY RTDGF+SPKEM +A Sbjct: 795 EGTVVPRACKELFWKMCKILHLFYFRTDGFSSPKEMASA 833 >ref|XP_020194762.1| ent-kaur-16-ene synthase, chloroplastic-like isoform X2 [Aegilops tauschii subsp. tauschii] Length = 851 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EG+VVPR CKELFWKM K+LHLFY RTDGF+SPKEM +A Sbjct: 800 EGTVVPRACKELFWKMCKILHLFYFRTDGFSSPKEMASA 838 >ref|XP_020194761.1| ent-kaur-16-ene synthase, chloroplastic-like isoform X1 [Aegilops tauschii subsp. tauschii] Length = 852 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EG+VVPR CKELFWKM K+LHLFY RTDGF+SPKEM +A Sbjct: 801 EGTVVPRACKELFWKMCKILHLFYFRTDGFSSPKEMASA 839 >emb|CBX87013.1| KS protein [Triticum aestivum] Length = 852 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EG+VVPR CKELFWKM K+LHLFY RTDGF+SPKEM +A Sbjct: 801 EGTVVPRACKELFWKMCKILHLFYFRTDGFSSPKEMASA 839 >dbj|BAL41693.1| ent-kaurene synthase like 6 [Triticum aestivum] Length = 852 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EG+VVPR CKELFWKM K+LHLFY RTDGF+SPKEM +A Sbjct: 801 EGTVVPRACKELFWKMCKILHLFYFRTDGFSSPKEMASA 839 >gb|OAY64804.1| Ent-kaur-16-ene synthase, chloroplastic, partial [Ananas comosus] Length = 1391 Score = 72.0 bits (175), Expect = 1e-11 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EGSV+PR CK+LFWKM ++LHLFY+ TDGFTSPKEM+ A Sbjct: 1234 EGSVIPRSCKDLFWKMCRILHLFYMNTDGFTSPKEMVTA 1272 Score = 67.4 bits (163), Expect = 4e-10 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMM 113 EG+V+PR CK+LFW M ++LHLFY+ TDGFTSPKEM+ Sbjct: 483 EGTVIPRSCKDLFWNMCRILHLFYMNTDGFTSPKEMI 519 >ref|XP_020103574.1| ent-kaur-16-ene synthase, chloroplastic-like [Ananas comosus] Length = 816 Score = 71.2 bits (173), Expect = 2e-11 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EG+V+PR CK+LFWKM ++LHLFY+ TDGFTSPKEM++A Sbjct: 751 EGTVIPRSCKDLFWKMCRILHLFYMNTDGFTSPKEMVSA 789 >gb|PKA52242.1| Ent-kaur-16-ene synthase, chloroplastic [Apostasia shenzhenica] Length = 790 Score = 70.5 bits (171), Expect(2) = 2e-11 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 +GS VP+ CKELFWKMSK+LHLFY TDGFTSPKEM+ A Sbjct: 733 KGSKVPKSCKELFWKMSKILHLFYKNTDGFTSPKEMLGA 771 Score = 25.4 bits (54), Expect(2) = 2e-11 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 Query: 118 LIHEPPKVGHLQLSAN 165 +IHEP KV HL LSA+ Sbjct: 775 VIHEPLKVSHLLLSAD 790 >ref|XP_017701627.1| PREDICTED: ent-kaur-16-ene synthase, chloroplastic isoform X3 [Phoenix dactylifera] Length = 724 Score = 70.5 bits (171), Expect = 3e-11 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EGSVVPR CK+LFWKMS++LHLFY++ DGFTSP EM++A Sbjct: 667 EGSVVPRACKDLFWKMSRILHLFYMKNDGFTSPTEMVSA 705 >ref|XP_017701626.1| PREDICTED: ent-kaur-16-ene synthase, chloroplastic isoform X2 [Phoenix dactylifera] Length = 807 Score = 70.5 bits (171), Expect = 3e-11 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +3 Query: 3 EGSVVPRDCKELFWKMSKVLHLFYLRTDGFTSPKEMMAA 119 EGSVVPR CK+LFWKMS++LHLFY++ DGFTSP EM++A Sbjct: 750 EGSVVPRACKDLFWKMSRILHLFYMKNDGFTSPTEMVSA 788