BLASTX nr result
ID: Ophiopogon22_contig00033034
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00033034 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267466.1| ubiquitin-like-specific protease 1D [Asparag... 62 1e-08 >ref|XP_020267466.1| ubiquitin-like-specific protease 1D [Asparagus officinalis] gb|ONK68435.1| uncharacterized protein A4U43_C05F11470 [Asparagus officinalis] Length = 456 Score = 61.6 bits (148), Expect = 1e-08 Identities = 44/90 (48%), Positives = 53/90 (58%), Gaps = 2/90 (2%) Frame = -3 Query: 264 RQGAVFSEELRLISHVKCRTLRENGLQNQVERRPLEKSPHAVRTSSSVLYPKKDIQRFSN 85 + GA FSEEL ++S + LRENGL Q ER+PL+K P R KD FS Sbjct: 68 KTGAAFSEELSIMS----KHLRENGLSLQEERQPLQKRPKVTR---------KDKCGFST 114 Query: 84 CKFSDIGCPKTIPLS--QARKNLSRRLSKR 1 KF+D T+ +S QARKNLSRRLSKR Sbjct: 115 FKFAD-----TVNISSLQARKNLSRRLSKR 139