BLASTX nr result
ID: Ophiopogon22_contig00033006
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00033006 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273559.1| pentatricopeptide repeat-containing protein ... 194 1e-54 gb|PKU87418.1| Pentatricopeptide repeat-containing protein [Dend... 148 2e-38 ref|XP_020695065.1| pentatricopeptide repeat-containing protein ... 148 2e-38 gb|PKA58554.1| Pentatricopeptide repeat-containing protein [Apos... 142 4e-36 ref|XP_020585016.1| pentatricopeptide repeat-containing protein ... 132 1e-32 ref|XP_023913469.1| pentatricopeptide repeat-containing protein ... 118 8e-28 ref|XP_009411321.1| PREDICTED: pentatricopeptide repeat-containi... 118 8e-28 gb|PIA43834.1| hypothetical protein AQUCO_01800109v1 [Aquilegia ... 115 7e-27 ref|XP_019706414.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 113 5e-26 ref|XP_012473083.1| PREDICTED: pentatricopeptide repeat-containi... 109 1e-24 gb|PPR98720.1| hypothetical protein GOBAR_AA21948 [Gossypium bar... 108 1e-24 ref|XP_017627070.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-24 gb|PPD66766.1| hypothetical protein GOBAR_DD36359 [Gossypium bar... 108 2e-24 gb|OAY84120.1| Pentatricopeptide repeat-containing protein, mito... 108 2e-24 gb|PKI46134.1| hypothetical protein CRG98_033467 [Punica granatum] 108 3e-24 gb|OWM84289.1| hypothetical protein CDL15_Pgr027058 [Punica gran... 108 3e-24 ref|XP_022753412.1| pentatricopeptide repeat-containing protein ... 106 1e-23 ref|XP_016712600.1| PREDICTED: pentatricopeptide repeat-containi... 105 2e-23 ref|XP_020103675.1| pentatricopeptide repeat-containing protein ... 105 2e-23 ref|XP_010277199.1| PREDICTED: pentatricopeptide repeat-containi... 103 8e-23 >ref|XP_020273559.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Asparagus officinalis] ref|XP_020273560.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Asparagus officinalis] ref|XP_020273561.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Asparagus officinalis] gb|ONK62759.1| uncharacterized protein A4U43_C07F7840 [Asparagus officinalis] Length = 1072 Score = 194 bits (494), Expect = 1e-54 Identities = 105/152 (69%), Positives = 124/152 (81%), Gaps = 1/152 (0%) Frame = -3 Query: 454 KTLSPSALIKIGIAPSIKSLNLLLS-VLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAH 278 KTL S L+K+GI PS K+LNL LS +L+SQ PNL LHLFSQI SNSIK NSKTCSLVA Sbjct: 13 KTLVFSNLVKLGITPSTKTLNLFLSFLLKSQKPNLLLHLFSQISSNSIKINSKTCSLVAQ 72 Query: 277 SLLQSRRFEEAQDIVSFAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVYGI 98 SLL+ +FE A++I S A+RF+FV KRG+W+S+IQC C E NPERAFS+L+QC++ YGI Sbjct: 73 SLLELHQFE-AEEITSCAERFNFVLKRGIWNSVIQCICVKEENPERAFSILSQCIENYGI 131 Query: 97 TPSFATFRSLVLKFSSCNEMERAIEVLELMRS 2 PS ATFR LVLKFSS +MERAIEVLELMRS Sbjct: 132 FPSSATFRPLVLKFSSQGKMERAIEVLELMRS 163 >gb|PKU87418.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 1104 Score = 148 bits (374), Expect = 2e-38 Identities = 79/152 (51%), Positives = 110/152 (72%), Gaps = 1/152 (0%) Frame = -3 Query: 454 KTLSPSALIKIGIAPSIKSLNLLLS-VLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAH 278 K LSP L+K ++P I+SLNL L+ +L ++ L L FSQ+ SNS++ +SKT LV H Sbjct: 26 KILSPQTLLKSCVSPCIRSLNLFLTFLLRNRKITLLLETFSQLSSNSVQIDSKTHFLVTH 85 Query: 277 SLLQSRRFEEAQDIVSFAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVYGI 98 +LL+SRRFEEAQ +S A+++DFV ++ +WDS+I+ C +PERA SLL++C+ GI Sbjct: 86 ALLRSRRFEEAQQFISPAEKYDFVVRKSLWDSLIREVCVSGGDPERALSLLHECMRNRGI 145 Query: 97 TPSFATFRSLVLKFSSCNEMERAIEVLELMRS 2 +PS +TFR LVL FS+ MERAIEVLE+M S Sbjct: 146 SPSLSTFRLLVLSFSAQGRMERAIEVLEIMTS 177 >ref|XP_020695065.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695066.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695067.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695068.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695069.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695070.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] Length = 1104 Score = 148 bits (374), Expect = 2e-38 Identities = 79/152 (51%), Positives = 110/152 (72%), Gaps = 1/152 (0%) Frame = -3 Query: 454 KTLSPSALIKIGIAPSIKSLNLLLS-VLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAH 278 K LSP L+K ++P I+SLNL L+ +L ++ L L FSQ+ SNS++ +SKT LV H Sbjct: 26 KILSPQTLLKSCVSPCIRSLNLFLTFLLRNRKITLLLETFSQLSSNSVQIDSKTHFLVTH 85 Query: 277 SLLQSRRFEEAQDIVSFAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVYGI 98 +LL+SRRFEEAQ +S A+++DFV ++ +WDS+I+ C +PERA SLL++C+ GI Sbjct: 86 ALLRSRRFEEAQQFISPAEKYDFVVRKSLWDSLIREVCVSGGDPERALSLLHECMRNRGI 145 Query: 97 TPSFATFRSLVLKFSSCNEMERAIEVLELMRS 2 +PS +TFR LVL FS+ MERAIEVLE+M S Sbjct: 146 SPSLSTFRLLVLSFSAQGRMERAIEVLEIMTS 177 >gb|PKA58554.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 1068 Score = 142 bits (357), Expect = 4e-36 Identities = 78/151 (51%), Positives = 106/151 (70%), Gaps = 1/151 (0%) Frame = -3 Query: 451 TLSPSALIKIGIAPSIKSLNLLLS-VLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAHS 275 TLSP +L+K + PSI+SLN+ LS +L + +L L F+QI SNSI+ +S T LV H+ Sbjct: 31 TLSPQSLLKRCVRPSIRSLNIFLSFLLRKRKLSLLLETFAQISSNSIEIDSNTHFLVTHA 90 Query: 274 LLQSRRFEEAQDIVSFAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVYGIT 95 LL+SRR+EEA+ + A+++DFV ++ +WDS+I+ C G PERA +LL +CV GI+ Sbjct: 91 LLKSRRYEEAEQFILPAEKYDFVVRKSLWDSLIRGMCVGGGKPERALNLLQECVRTQGIS 150 Query: 94 PSFATFRSLVLKFSSCNEMERAIEVLELMRS 2 PS TFRSLVL SS ME AIEVLE+M S Sbjct: 151 PSPFTFRSLVLALSSQGRMEWAIEVLEIMSS 181 >ref|XP_020585016.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Phalaenopsis equestris] ref|XP_020585017.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Phalaenopsis equestris] ref|XP_020585018.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Phalaenopsis equestris] Length = 1125 Score = 132 bits (331), Expect = 1e-32 Identities = 74/149 (49%), Positives = 99/149 (66%), Gaps = 1/149 (0%) Frame = -3 Query: 445 SPSALIKIGIAPSIKSLNLLLS-VLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAHSLL 269 SP L+K I P ++SLNL LS +L S+ L L FSQ SNSI+ +SKT L+ +LL Sbjct: 49 SPQTLLKSCIIPCVRSLNLFLSFLLRSRKFTLLLETFSQFSSNSIQIDSKTHFLITRALL 108 Query: 268 QSRRFEEAQDIVSFAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVYGITPS 89 +SRRFEEA + A ++FV K+ +WDS+I+ C +PER+ SLL++C+ GI P+ Sbjct: 109 KSRRFEEALQFIYPADNYNFVVKKSLWDSLIRELCVAGGDPERSLSLLHECMRNRGILPA 168 Query: 88 FATFRSLVLKFSSCNEMERAIEVLELMRS 2 TFRSLVL FSS ME+AIE LE+M S Sbjct: 169 LITFRSLVLSFSSQGRMEKAIEALEIMTS 197 >ref|XP_023913469.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Quercus suber] ref|XP_023913470.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Quercus suber] ref|XP_023913471.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Quercus suber] ref|XP_023913472.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Quercus suber] ref|XP_023913474.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Quercus suber] ref|XP_023913475.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Quercus suber] Length = 1077 Score = 118 bits (295), Expect = 8e-28 Identities = 70/148 (47%), Positives = 95/148 (64%), Gaps = 2/148 (1%) Frame = -3 Query: 445 SPSALIKIGIAPSIKSLN-LLLSVLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAHSLL 269 S L+K G P++KS+N LL + ++ + +H FSQ+ SN IKPNS T S++ +LL Sbjct: 16 SLQTLLKRGFTPTLKSINKFLLFLSQTHRYDSIIHFFSQLSSNQIKPNSHTHSILTWALL 75 Query: 268 QSRRFEEAQDIVSFAKRFDFV-PKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVYGITP 92 +S +F+EA+ F K D + PK +WDS+IQ C + NPE+A SLL C+ GI P Sbjct: 76 KSHKFDEAEH---FMKTHDQIAPKTRMWDSLIQGLCTKQNNPEKALSLLQFCLRNNGIVP 132 Query: 91 SFATFRSLVLKFSSCNEMERAIEVLELM 8 S TF SL+L+FSS M RAIEVLELM Sbjct: 133 SSFTFFSLILRFSSEGNMGRAIEVLELM 160 >ref|XP_009411321.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 1083 Score = 118 bits (295), Expect = 8e-28 Identities = 71/151 (47%), Positives = 99/151 (65%), Gaps = 3/151 (1%) Frame = -3 Query: 457 LKTLSPSALIKIGI-APSIKSLNLLLSVL--ESQSPNLSLHLFSQILSNSIKPNSKTCSL 287 L+ +P LIK G+ APS++S NLLLS L E++ P L L LFSQI SNS+ + +T SL Sbjct: 2 LQLSTPQRLIKAGLTAPSVRSFNLLLSFLLFEARKPRLVLCLFSQITSNSLPVDPRTHSL 61 Query: 286 VAHSLLQSRRFEEAQDIVSFAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDV 107 VA +L++SRRF +A +S A DF +R + +S+I+ C E NP+ A SLL +CV Sbjct: 62 VARALVRSRRFHDAGRFISRAP-LDFGFRRSLVESLIRRLCVAERNPDGALSLLQECVRN 120 Query: 106 YGITPSFATFRSLVLKFSSCNEMERAIEVLE 14 G+ PS +FRS+V F S ++RA+EVLE Sbjct: 121 RGVFPSLGSFRSVVAAFCSLGRLDRAVEVLE 151 >gb|PIA43834.1| hypothetical protein AQUCO_01800109v1 [Aquilegia coerulea] Length = 1080 Score = 115 bits (288), Expect = 7e-27 Identities = 63/150 (42%), Positives = 94/150 (62%), Gaps = 1/150 (0%) Frame = -3 Query: 454 KTLSPSALIKIGIAPSIKSLNLLLSVL-ESQSPNLSLHLFSQILSNSIKPNSKTCSLVAH 278 KTLS L+K G +P++KS N L+ L ++ N +LH FSQ+ SN I+ NS+T S++ Sbjct: 37 KTLSLQNLLKSGFSPTLKSFNQFLTFLFKNHKFNSALHFFSQMNSNHIRGNSETRSIIVG 96 Query: 277 SLLQSRRFEEAQDIVSFAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVYGI 98 +++ RF+EA+ ++ + ++G+WDS+IQ C+ +PE+AFS+L C+ G Sbjct: 97 IFIKTNRFQEAEQFMTQMLKDGEFFQKGIWDSLIQGICSAGKSPEKAFSVLQDCLKFRGF 156 Query: 97 TPSFATFRSLVLKFSSCNEMERAIEVLELM 8 PS TF L+ FSS M RAIEVLELM Sbjct: 157 LPSCYTFGLLIHSFSSLGNMSRAIEVLELM 186 >ref|XP_019706414.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Elaeis guineensis] Length = 1080 Score = 113 bits (282), Expect = 5e-26 Identities = 65/142 (45%), Positives = 96/142 (67%), Gaps = 1/142 (0%) Frame = -3 Query: 430 IKIGIAPSIKSLNLLLS-VLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRRF 254 +K G+ SI++LN LS +L++++ L LFSQI SNS+ +++ SL+A +LL+S RF Sbjct: 1 MKSGLGASIQTLNPFLSFLLKTRNLRLLRPLFSQISSNSVSIDTQIHSLIAQALLKSHRF 60 Query: 253 EEAQDIVSFAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVYGITPSFATFR 74 +EA+ +S A+ F+P++ +W S+IQ C E +P+RA SLL +CV G PS TFR Sbjct: 61 KEAEQFLSHAQNIAFLPRKRLWSSLIQGVCVEEEDPDRALSLLQECVRNGG--PSSNTFR 118 Query: 73 SLVLKFSSCNEMERAIEVLELM 8 +LV FSS MERA EVL++M Sbjct: 119 ALVASFSSRGMMERAFEVLDVM 140 >ref|XP_012473083.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] ref|XP_012473084.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] ref|XP_012473085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] ref|XP_012473086.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] ref|XP_012473087.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] ref|XP_012473089.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] gb|KJB22015.1| hypothetical protein B456_004G025400 [Gossypium raimondii] Length = 1072 Score = 109 bits (272), Expect = 1e-24 Identities = 71/152 (46%), Positives = 92/152 (60%), Gaps = 3/152 (1%) Frame = -3 Query: 454 KTLSPSALIKIGIAPSIKSLN-LLLSVLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAH 278 KT L+K G P++KS+N LLL + S+ N +HLFSQ+ SN I PNS+T S++ Sbjct: 17 KTPPLQTLLKRGFTPTLKSINQLLLFLSRSRRFNAVIHLFSQLDSNKINPNSQTHSILIC 76 Query: 277 SLLQSRRFEEAQDIVS--FAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVY 104 SLL+ +FEEA+ +VS +K DF PK WDS+IQ NPE+ LL C+ Sbjct: 77 SLLKLHKFEEAEHLVSTQMSKYPDF-PKTRFWDSLIQGFGVIRNNPEKGLLLLKDCLRDS 135 Query: 103 GITPSFATFRSLVLKFSSCNEMERAIEVLELM 8 G PS TF SL+ F S M+RAIEVLELM Sbjct: 136 GTLPSSFTFCSLIHSFVSQGNMDRAIEVLELM 167 >gb|PPR98720.1| hypothetical protein GOBAR_AA21948 [Gossypium barbadense] Length = 1002 Score = 108 bits (271), Expect = 1e-24 Identities = 71/152 (46%), Positives = 92/152 (60%), Gaps = 3/152 (1%) Frame = -3 Query: 454 KTLSPSALIKIGIAPSIKSLN-LLLSVLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAH 278 KT L+K G P++KS+N LLL + S+ N +HLFSQ+ SN I PNS+T S++ Sbjct: 17 KTPPLQTLLKRGFTPTLKSINQLLLFLSHSRRFNAVIHLFSQLDSNKINPNSQTHSILIC 76 Query: 277 SLLQSRRFEEAQDIVS--FAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVY 104 SLL+ +FEEA+ +VS +K DF PK WDS+IQ NPE+ LL C+ Sbjct: 77 SLLKLHKFEEAEHLVSTQMSKCPDF-PKTRFWDSLIQGFGVIRNNPEKGLLLLKDCLSDS 135 Query: 103 GITPSFATFRSLVLKFSSCNEMERAIEVLELM 8 G PS TF SL+ F S M+RAIEVLELM Sbjct: 136 GTLPSSFTFCSLIHGFVSQGNMDRAIEVLELM 167 >ref|XP_017627070.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium arboreum] ref|XP_017627071.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium arboreum] ref|XP_017627072.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium arboreum] Length = 1074 Score = 108 bits (271), Expect = 1e-24 Identities = 71/152 (46%), Positives = 92/152 (60%), Gaps = 3/152 (1%) Frame = -3 Query: 454 KTLSPSALIKIGIAPSIKSLN-LLLSVLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAH 278 KT L+K G P++KS+N LLL + S+ N +HLFSQ+ SN I PNS+T S++ Sbjct: 17 KTPPLQTLLKRGFTPTLKSINQLLLFLSHSRRFNAVIHLFSQLDSNKINPNSQTHSILIC 76 Query: 277 SLLQSRRFEEAQDIVS--FAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVY 104 SLL+ +FEEA+ +VS +K DF PK WDS+IQ NPE+ LL C+ Sbjct: 77 SLLKLHKFEEAEHLVSTQMSKCPDF-PKTRFWDSLIQGFGVIRNNPEKGLLLLKDCLSDS 135 Query: 103 GITPSFATFRSLVLKFSSCNEMERAIEVLELM 8 G PS TF SL+ F S M+RAIEVLELM Sbjct: 136 GTLPSSFTFCSLIHGFVSQGNMDRAIEVLELM 167 >gb|PPD66766.1| hypothetical protein GOBAR_DD36359 [Gossypium barbadense] Length = 629 Score = 108 bits (270), Expect = 2e-24 Identities = 71/152 (46%), Positives = 92/152 (60%), Gaps = 3/152 (1%) Frame = -3 Query: 454 KTLSPSALIKIGIAPSIKSLN-LLLSVLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAH 278 KT L+K G P++KS+N LLL + S+ N +HLFSQ+ SN I PNS+T S++ Sbjct: 17 KTPPLQTLLKRGFTPTVKSINQLLLFLSHSRRFNAVIHLFSQLDSNKINPNSQTHSILIC 76 Query: 277 SLLQSRRFEEAQDIVS--FAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVY 104 SLL+ +FEEA+ +VS +K DF PK WDS+IQ NPE+ LL C+ Sbjct: 77 SLLKLHKFEEAEHLVSTQMSKCPDF-PKTRFWDSLIQGFGVIRNNPEKGLLLLKDCLRDS 135 Query: 103 GITPSFATFRSLVLKFSSCNEMERAIEVLELM 8 G PS TF SL+ F S M+RAIEVLELM Sbjct: 136 GTLPSSFTFCSLIHGFVSQGNMDRAIEVLELM 167 >gb|OAY84120.1| Pentatricopeptide repeat-containing protein, mitochondrial [Ananas comosus] Length = 942 Score = 108 bits (269), Expect = 2e-24 Identities = 62/151 (41%), Positives = 91/151 (60%), Gaps = 2/151 (1%) Frame = -3 Query: 454 KTLSPSALIKIGIAPSIKSLNLLLS-VLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAH 278 +T + LIK G APS ++L LS +L S+ P+L L LF + S I+ + +T +LVA Sbjct: 31 ETQTLQTLIKSGSAPSAQTLAPFLSFLLRSRKPHLLLRLFPHLSSEPIRSDPRTLTLVAR 90 Query: 277 SLLQSRRFEEAQDIVSFAK-RFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVYG 101 +LL+S R +EA +S A+ R F G+WDS+I+ C + +P +A +L +CV G Sbjct: 91 ALLESHRLDEAARFISRAEHRLSFASDIGLWDSLIRRVCVFDADPRKALTLFQECVRYRG 150 Query: 100 ITPSFATFRSLVLKFSSCNEMERAIEVLELM 8 I PS TFR LV F S +ME A+EV ++M Sbjct: 151 IVPSLITFRVLVSSFCSQGDMESAVEVFDVM 181 >gb|PKI46134.1| hypothetical protein CRG98_033467 [Punica granatum] Length = 1063 Score = 108 bits (269), Expect = 3e-24 Identities = 65/143 (45%), Positives = 88/143 (61%), Gaps = 1/143 (0%) Frame = -3 Query: 433 LIKIGIAPSIKSLNL-LLSVLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 257 L+K G P+++ LN LL + ES N +H F Q+ SN+IKPNS + S +A +LL RR Sbjct: 44 LLKRGFHPTVEHLNRHLLFLSESHRFNSVIHFFPQLESNNIKPNSYSHSFLARALLNLRR 103 Query: 256 FEEAQDIVSFAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVYGITPSFATF 77 F+EA+ ++ A F + +WDS+IQ C + +PE+ FS+L C GI PS TF Sbjct: 104 FDEAEHLMRKAPNF---ARSSMWDSLIQGYCVHQRDPEKGFSVLLDCFGKDGILPSSYTF 160 Query: 76 RSLVLKFSSCNEMERAIEVLELM 8 SL+ FSS M RAIEVLELM Sbjct: 161 CSLIHSFSSLGMMGRAIEVLELM 183 >gb|OWM84289.1| hypothetical protein CDL15_Pgr027058 [Punica granatum] Length = 1074 Score = 108 bits (269), Expect = 3e-24 Identities = 65/143 (45%), Positives = 88/143 (61%), Gaps = 1/143 (0%) Frame = -3 Query: 433 LIKIGIAPSIKSLNL-LLSVLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 257 L+K G P+++ LN LL + ES N +H F Q+ SN+IKPNS + S +A +LL RR Sbjct: 44 LLKRGFHPTVEHLNRHLLFLSESHRFNSVIHFFPQLESNNIKPNSYSHSFLARALLNLRR 103 Query: 256 FEEAQDIVSFAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVYGITPSFATF 77 F+EA+ ++ A F + +WDS+IQ C + +PE+ FS+L C GI PS TF Sbjct: 104 FDEAEHLMRKAPNF---ARSSMWDSLIQGYCVHQRDPEKGFSVLLDCFGKDGILPSSYTF 160 Query: 76 RSLVLKFSSCNEMERAIEVLELM 8 SL+ FSS M RAIEVLELM Sbjct: 161 CSLIHSFSSLGMMGRAIEVLELM 183 >ref|XP_022753412.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial isoform X1 [Durio zibethinus] Length = 1090 Score = 106 bits (264), Expect = 1e-23 Identities = 67/153 (43%), Positives = 93/153 (60%), Gaps = 2/153 (1%) Frame = -3 Query: 460 PLKTLSPSALIKIGIAPSIKSLNLLLSVLE-SQSPNLSLHLFSQILSNSIKPNSKTCSLV 284 PL+TL IK G P++KS+N LLS L S+ N +HLFSQ+ SN IK N +T S++ Sbjct: 26 PLQTL-----IKRGFTPTLKSINQLLSFLSYSRKFNSVVHLFSQLESNKIKANFQTHSIL 80 Query: 283 AHSLLQSRRFEEAQDIVSFA-KRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDV 107 +LL+ +FEEA+ +++ +F K WDS+IQ C + NP++ LL C+ Sbjct: 81 IWALLRLYKFEEAEHLMNTRLSKFSNFSKTRFWDSLIQGFCVIQNNPQKGLFLLKNCLMN 140 Query: 106 YGITPSFATFRSLVLKFSSCNEMERAIEVLELM 8 G PS +TF SL+ F S M+RAIEVLELM Sbjct: 141 CGTLPSSSTFCSLIHSFISQGNMDRAIEVLELM 173 >ref|XP_016712600.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium hirsutum] ref|XP_016712601.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium hirsutum] ref|XP_016712602.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium hirsutum] ref|XP_016712603.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium hirsutum] Length = 1074 Score = 105 bits (263), Expect = 2e-23 Identities = 70/152 (46%), Positives = 91/152 (59%), Gaps = 3/152 (1%) Frame = -3 Query: 454 KTLSPSALIKIGIAPSIKSLN-LLLSVLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAH 278 KT L+K G P++KS+N LLL + S+ N +HLFSQ+ S I PNS+T S++ Sbjct: 17 KTPPLQTLLKRGFTPTLKSINQLLLFLSHSRRFNAVIHLFSQLDSYKINPNSQTHSILIC 76 Query: 277 SLLQSRRFEEAQDIVS--FAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVY 104 SLL+ +FEEA+ +VS +K DF PK WDS+IQ NPE+ LL C+ Sbjct: 77 SLLKLHKFEEAEHLVSTQMSKCPDF-PKTRFWDSLIQGFGVIRNNPEKGLLLLKDCLSDS 135 Query: 103 GITPSFATFRSLVLKFSSCNEMERAIEVLELM 8 G PS TF SL+ F S M+RAIEVLELM Sbjct: 136 GTLPSSFTFCSLIHGFVSQGNMDRAIEVLELM 167 >ref|XP_020103675.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Ananas comosus] ref|XP_020103676.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Ananas comosus] Length = 1099 Score = 105 bits (262), Expect = 2e-23 Identities = 61/151 (40%), Positives = 90/151 (59%), Gaps = 2/151 (1%) Frame = -3 Query: 454 KTLSPSALIKIGIAPSIKSLNLLLS-VLESQSPNLSLHLFSQILSNSIKPNSKTCSLVAH 278 +T + LIK G APS ++L LS +L S+ P+L L LF + S I+ + +T +LVA Sbjct: 31 ETQTLQTLIKSGSAPSAQTLAPFLSFLLRSRKPHLLLRLFPNLSSEPIRSDPRTLTLVAR 90 Query: 277 SLLQSRRFEEAQDIVSFAK-RFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVYG 101 +LL+S R +EA +S + R F G+WDS+I+ C + +P +A +L +CV G Sbjct: 91 ALLESHRLDEAARFISRDEDRLGFASDIGLWDSLIRRVCVFDADPRKALTLFQECVRYRG 150 Query: 100 ITPSFATFRSLVLKFSSCNEMERAIEVLELM 8 I PS TFR LV F S +ME A+EV ++M Sbjct: 151 IVPSLITFRVLVSSFCSQGDMESAVEVFDVM 181 >ref|XP_010277199.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Nelumbo nucifera] ref|XP_010277200.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Nelumbo nucifera] ref|XP_010277201.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Nelumbo nucifera] ref|XP_010277202.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Nelumbo nucifera] ref|XP_010277203.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Nelumbo nucifera] Length = 1092 Score = 103 bits (258), Expect = 8e-23 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 1/152 (0%) Frame = -3 Query: 460 PLKTLSPSALIKIGIAPSIKSLNLLLSVLESQSPNLS-LHLFSQILSNSIKPNSKTCSLV 284 PL+TL +K G P++KSLN L L S LH FSQ+ SN I NS+T +V Sbjct: 56 PLQTL-----LKSGFIPTLKSLNHFLIFLSRNHRFESVLHFFSQMNSNGINGNSRTQCIV 110 Query: 283 AHSLLQSRRFEEAQDIVSFAKRFDFVPKRGVWDSIIQCACAGEVNPERAFSLLNQCVDVY 104 A +LL +R EEA++ V+ ++ PK+ + DS+I+ C +PE+AF LL C+ Sbjct: 111 ARALLYEKRLEEAENFVAQMEKHGVFPKKWLLDSLIRGLCTDGRDPEKAFYLLQNCLRNR 170 Query: 103 GITPSFATFRSLVLKFSSCNEMERAIEVLELM 8 GI+PS F L+ FSS +M+RAIEV+E M Sbjct: 171 GISPSSLNFSLLIHSFSSQGKMDRAIEVMESM 202