BLASTX nr result
ID: Ophiopogon22_contig00032906
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00032906 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA56521.1| Pentatricopeptide repeat-containing protein [Apos... 64 4e-09 ref|XP_010920183.1| PREDICTED: pentatricopeptide repeat-containi... 61 5e-08 ref|XP_020688971.1| pentatricopeptide repeat-containing protein ... 59 1e-07 ref|XP_020691536.1| pentatricopeptide repeat-containing protein ... 59 2e-07 ref|XP_020688970.1| pentatricopeptide repeat-containing protein ... 59 2e-07 ref|XP_009382027.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-07 ref|XP_008788464.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-07 ref|XP_020581244.1| pentatricopeptide repeat-containing protein ... 57 1e-06 gb|KMZ57381.1| Pentatricopeptide repeat-containing protein [Zost... 56 3e-06 >gb|PKA56521.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 752 Score = 63.9 bits (154), Expect = 4e-09 Identities = 34/67 (50%), Positives = 47/67 (70%) Frame = +3 Query: 207 CLLQSFDRFVALNRLSDAVAALPVLASSGIRPAFSTLARLLSQSLRLHSPSALSLARRLH 386 CLL+S R +++ R++DAVA LP+LA+ G+RP +L LLS L P +L LARR+ Sbjct: 282 CLLESLHRNLSIGRIADAVAVLPLLAAGGLRPPTRSLVLLLSHCLCY--PPSLPLARRVF 339 Query: 387 LYLHLTG 407 L+LHLTG Sbjct: 340 LFLHLTG 346 >ref|XP_010920183.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 [Elaeis guineensis] ref|XP_010920184.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 [Elaeis guineensis] Length = 599 Score = 60.8 bits (146), Expect = 5e-08 Identities = 36/76 (47%), Positives = 46/76 (60%) Frame = +3 Query: 180 PNRTXXXXXCLLQSFDRFVALNRLSDAVAALPVLASSGIRPAFSTLARLLSQSLRLHSPS 359 P+ CLL S ++L R+ AV ALP+LA G+RP TLA LLSQ LR Sbjct: 4 PDNKSSRPSCLLLSLHHHLSLGRVDLAVDALPLLACRGLRPDLPTLALLLSQCLR---SG 60 Query: 360 ALSLARRLHLYLHLTG 407 +L LARR+HL+L L+G Sbjct: 61 SLPLARRVHLFLRLSG 76 >ref|XP_020688971.1| pentatricopeptide repeat-containing protein At2g21090-like isoform X2 [Dendrobium catenatum] Length = 399 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/66 (48%), Positives = 43/66 (65%) Frame = +3 Query: 207 CLLQSFDRFVALNRLSDAVAALPVLASSGIRPAFSTLARLLSQSLRLHSPSALSLARRLH 386 CLL +R ++ RL+DAV+ LP LA G+RP TL+ LLS LHSP++L LA R+ Sbjct: 14 CLLADLNRHISAGRLADAVSVLPFLARHGLRPPTRTLSLLLSHC--LHSPASLPLASRVL 71 Query: 387 LYLHLT 404 +LH T Sbjct: 72 NFLHFT 77 >ref|XP_020691536.1| pentatricopeptide repeat-containing protein At2g21090-like [Dendrobium catenatum] Length = 442 Score = 59.3 bits (142), Expect = 2e-07 Identities = 32/66 (48%), Positives = 43/66 (65%) Frame = +3 Query: 207 CLLQSFDRFVALNRLSDAVAALPVLASSGIRPAFSTLARLLSQSLRLHSPSALSLARRLH 386 CLL +R ++ RL+DAV+ LP LA G+RP TL+ LLS LHSP++L LA R+ Sbjct: 14 CLLADLNRHISAGRLADAVSVLPFLARHGLRPPTRTLSLLLSHC--LHSPASLPLASRVL 71 Query: 387 LYLHLT 404 +LH T Sbjct: 72 NFLHFT 77 >ref|XP_020688970.1| pentatricopeptide repeat-containing protein At2g21090-like isoform X1 [Dendrobium catenatum] gb|PKU64590.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 588 Score = 59.3 bits (142), Expect = 2e-07 Identities = 32/66 (48%), Positives = 43/66 (65%) Frame = +3 Query: 207 CLLQSFDRFVALNRLSDAVAALPVLASSGIRPAFSTLARLLSQSLRLHSPSALSLARRLH 386 CLL +R ++ RL+DAV+ LP LA G+RP TL+ LLS LHSP++L LA R+ Sbjct: 14 CLLADLNRHISAGRLADAVSVLPFLARHGLRPPTRTLSLLLSHC--LHSPASLPLASRVL 71 Query: 387 LYLHLT 404 +LH T Sbjct: 72 NFLHFT 77 >ref|XP_009382027.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 [Musa acuminata subsp. malaccensis] ref|XP_018676167.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 [Musa acuminata subsp. malaccensis] Length = 587 Score = 58.9 bits (141), Expect = 2e-07 Identities = 35/67 (52%), Positives = 44/67 (65%) Frame = +3 Query: 207 CLLQSFDRFVALNRLSDAVAALPVLASSGIRPAFSTLARLLSQSLRLHSPSALSLARRLH 386 CLLQS +A+ L AV LP+LA G+RP +TLA LL LR SP+AL LA R+H Sbjct: 8 CLLQSLRHCLAVGHLDLAVDTLPLLARCGLRPDSATLALLLRLCLR--SPAALPLAGRVH 65 Query: 387 LYLHLTG 407 L+L L+G Sbjct: 66 LFLRLSG 72 >ref|XP_008788464.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 [Phoenix dactylifera] Length = 599 Score = 58.9 bits (141), Expect = 2e-07 Identities = 35/67 (52%), Positives = 44/67 (65%) Frame = +3 Query: 207 CLLQSFDRFVALNRLSDAVAALPVLASSGIRPAFSTLARLLSQSLRLHSPSALSLARRLH 386 CLL S ++L RL AV ALP+LA G+RP STL+ LL Q LR +L LARR+H Sbjct: 13 CLLLSLHHHLSLGRLDLAVDALPLLARRGLRPDPSTLSLLLGQCLR---SGSLPLARRVH 69 Query: 387 LYLHLTG 407 L+L L+G Sbjct: 70 LFLRLSG 76 >ref|XP_020581244.1| pentatricopeptide repeat-containing protein At2g21090-like [Phalaenopsis equestris] ref|XP_020581245.1| pentatricopeptide repeat-containing protein At2g21090-like [Phalaenopsis equestris] ref|XP_020581247.1| pentatricopeptide repeat-containing protein At2g21090-like [Phalaenopsis equestris] ref|XP_020581248.1| pentatricopeptide repeat-containing protein At2g21090-like [Phalaenopsis equestris] Length = 570 Score = 57.0 bits (136), Expect = 1e-06 Identities = 33/66 (50%), Positives = 42/66 (63%) Frame = +3 Query: 207 CLLQSFDRFVALNRLSDAVAALPVLASSGIRPAFSTLARLLSQSLRLHSPSALSLARRLH 386 CLL S ++ RL+DAVA LP LA G+RP TL+ LL+Q L H +LSLARR+ Sbjct: 14 CLLASLKLHISAGRLADAVAVLPFLARCGLRPPIRTLSFLLTQCLYPH--PSLSLARRVL 71 Query: 387 LYLHLT 404 +LH T Sbjct: 72 HFLHFT 77 >gb|KMZ57381.1| Pentatricopeptide repeat-containing protein [Zostera marina] Length = 592 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/67 (43%), Positives = 42/67 (62%) Frame = +3 Query: 207 CLLQSFDRFVALNRLSDAVAALPVLASSGIRPAFSTLARLLSQSLRLHSPSALSLARRLH 386 CLL + ++ + + L AV LP+LA GIRP+ T A LL + +R S ++LAR +H Sbjct: 26 CLLSALEKHLENDELQQAVTLLPILARGGIRPSLHTYATLLHRCIRFKS---ITLARDVH 82 Query: 387 LYLHLTG 407 LYL +TG Sbjct: 83 LYLKITG 89