BLASTX nr result
ID: Ophiopogon22_contig00032509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00032509 (576 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020263024.1| uncharacterized protein LOC109839002 [Aspara... 42 1e-06 ref|XP_020250145.1| uncharacterized protein LOC109827551 [Aspara... 41 3e-06 >ref|XP_020263024.1| uncharacterized protein LOC109839002 [Asparagus officinalis] Length = 729 Score = 42.4 bits (98), Expect(2) = 1e-06 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = -1 Query: 555 GFGLRSISDMTIVGSQKLLWKICRVHTIWTTWMK 454 GFGLR ++D+ + + KL+W++ T+W+ WM+ Sbjct: 200 GFGLRKLNDLCLAAALKLIWRLLSTSTLWSNWMR 233 Score = 37.7 bits (86), Expect(2) = 1e-06 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = -3 Query: 466 NMDERHYNSMSTFWDAKSSPTDLDTWKFMLSNREKALCCTHTSFNKTSY 320 N Y FWD + D TWKF+ + KA+CC S Y Sbjct: 230 NWMRARYVRGGNFWDTPAHALDSGTWKFLSGIKSKAMCCIRKSIGNGEY 278 >ref|XP_020250145.1| uncharacterized protein LOC109827551 [Asparagus officinalis] Length = 1616 Score = 40.8 bits (94), Expect(2) = 3e-06 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -1 Query: 555 GFGLRSISDMTIVGSQKLLWKICRVHTIWTTWMK 454 GFGLR ++D+ KL+W++ T+W+ WMK Sbjct: 1273 GFGLRKLNDLCHAAGIKLIWRLITTSTLWSNWMK 1306 Score = 38.1 bits (87), Expect(2) = 3e-06 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -3 Query: 430 FWDAKSSPTDLDTWKFMLSNREKALCCTHTSFNK---TSYW 317 FWDA + D TWKF + KA+CC S TS W Sbjct: 1315 FWDAPAHAMDSGTWKFFSGLKSKAMCCIRKSIGNGETTSLW 1355