BLASTX nr result
ID: Ophiopogon22_contig00031812
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00031812 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65328.1| uncharacterized protein A4U43_C07F35990 [Asparagu... 60 4e-08 ref|XP_009778201.1| PREDICTED: transmembrane ascorbate ferriredu... 55 3e-06 ref|XP_019225966.1| PREDICTED: transmembrane ascorbate ferriredu... 54 5e-06 ref|XP_016433485.1| PREDICTED: transmembrane ascorbate ferriredu... 54 8e-06 ref|XP_009590952.1| PREDICTED: transmembrane ascorbate ferriredu... 54 8e-06 >gb|ONK65328.1| uncharacterized protein A4U43_C07F35990 [Asparagus officinalis] Length = 257 Score = 60.5 bits (145), Expect = 4e-08 Identities = 27/56 (48%), Positives = 37/56 (66%) Frame = -2 Query: 208 MAQLTRPASPIPVSLSSLGAHFSAVIVITLVFVWAIHFRGGFALHSDNVDLILNVH 41 MA + RP + + S +S+ AH A++ LV VWAIH+ GG +LHSDN L+ NVH Sbjct: 1 MAIIARPMALVAASYASVAAHLFALLAAILVLVWAIHYGGGLSLHSDNEALVFNVH 56 >ref|XP_009778201.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Nicotiana sylvestris] ref|XP_016515119.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Nicotiana tabacum] Length = 231 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/40 (57%), Positives = 29/40 (72%) Frame = -2 Query: 160 SLGAHFSAVIVITLVFVWAIHFRGGFALHSDNVDLILNVH 41 S GAHF AV+ +V VW+IHFRGG A +DN +LI N+H Sbjct: 11 SFGAHFLAVVAAIMVLVWSIHFRGGLAWEADNKNLIFNIH 50 >ref|XP_019225966.1| PREDICTED: transmembrane ascorbate ferrireductase 1 [Nicotiana attenuata] gb|OIT32336.1| transmembrane ascorbate ferrireductase 1 [Nicotiana attenuata] Length = 231 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/40 (55%), Positives = 29/40 (72%) Frame = -2 Query: 160 SLGAHFSAVIVITLVFVWAIHFRGGFALHSDNVDLILNVH 41 S GAHF A++ +V VW+IHFRGG A +DN +LI N+H Sbjct: 11 SFGAHFLALVAAVMVLVWSIHFRGGLAWEADNKNLIFNIH 50 >ref|XP_016433485.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Nicotiana tabacum] Length = 231 Score = 53.9 bits (128), Expect = 8e-06 Identities = 22/40 (55%), Positives = 29/40 (72%) Frame = -2 Query: 160 SLGAHFSAVIVITLVFVWAIHFRGGFALHSDNVDLILNVH 41 S GAHF A++ +V VW+IHFRGG A +DN +LI N+H Sbjct: 11 SFGAHFLALVAAIMVLVWSIHFRGGLAWEADNKNLIFNIH 50 >ref|XP_009590952.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Nicotiana tomentosiformis] Length = 231 Score = 53.9 bits (128), Expect = 8e-06 Identities = 22/40 (55%), Positives = 29/40 (72%) Frame = -2 Query: 160 SLGAHFSAVIVITLVFVWAIHFRGGFALHSDNVDLILNVH 41 S GAHF A++ +V VW+IHFRGG A +DN +LI N+H Sbjct: 11 SFGAHFLALVAAIMVLVWSIHFRGGLAWEADNKNLIFNIH 50