BLASTX nr result
ID: Ophiopogon22_contig00031723
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00031723 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK80455.1| uncharacterized protein A4U43_C01F17890 [Asparagu... 66 1e-11 ref|XP_020247388.1| LOW QUALITY PROTEIN: WD repeat-containing pr... 66 4e-10 gb|PIA33939.1| hypothetical protein AQUCO_03900061v1 [Aquilegia ... 63 4e-09 gb|PIN21428.1| hypothetical protein CDL12_05852 [Handroanthus im... 63 5e-09 gb|PIN05134.1| hypothetical protein CDL12_22331 [Handroanthus im... 63 5e-09 gb|EYU28108.1| hypothetical protein MIMGU_mgv1a008570mg [Erythra... 63 6e-09 ref|XP_012848471.1| PREDICTED: LOW QUALITY PROTEIN: cellulose sy... 63 7e-09 ref|XP_017234793.1| PREDICTED: WD repeat-containing protein 53 [... 62 2e-08 ref|XP_020097558.1| WD repeat-containing protein 53 [Ananas como... 61 2e-08 ref|XP_009408896.1| PREDICTED: WD repeat-containing protein 53 [... 61 2e-08 gb|OAY84422.1| WD repeat-containing protein 53, partial [Ananas ... 61 2e-08 gb|KMT04435.1| hypothetical protein BVRB_8g181100 isoform A [Bet... 61 3e-08 ref|XP_015621750.1| PREDICTED: WD repeat-containing protein 53 i... 61 3e-08 gb|KMT04436.1| hypothetical protein BVRB_8g181100 isoform B [Bet... 61 3e-08 ref|XP_022012044.1| WD repeat-containing protein 53 [Helianthus ... 61 3e-08 ref|XP_015621749.1| PREDICTED: WD repeat-containing protein 53 i... 61 3e-08 ref|XP_010686462.1| PREDICTED: cellulose synthase A catalytic su... 61 4e-08 ref|XP_022140168.1| cellulose synthase A catalytic subunit 8 [UD... 61 4e-08 ref|XP_020517775.1| WD repeat-containing protein 53 isoform X3 [... 60 4e-08 ref|XP_020517774.1| WD repeat-containing protein 53 isoform X2 [... 60 4e-08 >gb|ONK80455.1| uncharacterized protein A4U43_C01F17890 [Asparagus officinalis] Length = 104 Score = 66.2 bits (160), Expect = 1e-11 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTVP 140 KKVNWLCTTPSDSENLI+CDTSK LKVYTVP Sbjct: 74 KKVNWLCTTPSDSENLILCDTSKVLKVYTVP 104 >ref|XP_020247388.1| LOW QUALITY PROTEIN: WD repeat-containing protein 53 [Asparagus officinalis] Length = 372 Score = 66.2 bits (160), Expect = 4e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTVP 140 KKVNWLCTTPSDSENLI+CDTSK LKVYTVP Sbjct: 342 KKVNWLCTTPSDSENLILCDTSKVLKVYTVP 372 >gb|PIA33939.1| hypothetical protein AQUCO_03900061v1 [Aquilegia coerulea] Length = 301 Score = 63.2 bits (152), Expect = 4e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNWLCTTPSDSENL+VCDTSK +KVYTV Sbjct: 271 KKVNWLCTTPSDSENLVVCDTSKVVKVYTV 300 >gb|PIN21428.1| hypothetical protein CDL12_05852 [Handroanthus impetiginosus] Length = 382 Score = 63.2 bits (152), Expect = 5e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNWLCTTPSDSENL+VCDTSK +KVYTV Sbjct: 352 KKVNWLCTTPSDSENLVVCDTSKVVKVYTV 381 >gb|PIN05134.1| hypothetical protein CDL12_22331 [Handroanthus impetiginosus] Length = 382 Score = 63.2 bits (152), Expect = 5e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNWLCTTPSDSENL+VCDTSK +KVYTV Sbjct: 352 KKVNWLCTTPSDSENLVVCDTSKVVKVYTV 381 >gb|EYU28108.1| hypothetical protein MIMGU_mgv1a008570mg [Erythranthe guttata] Length = 369 Score = 62.8 bits (151), Expect = 6e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNWLCTTPSDSENL+VCDTSK +KVYTV Sbjct: 339 KKVNWLCTTPSDSENLVVCDTSKIVKVYTV 368 >ref|XP_012848471.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic subunit 8 [UDP-forming] [Erythranthe guttata] Length = 1389 Score = 62.8 bits (151), Expect = 7e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNWLCTTPSDSENL+VCDTSK +KVYTV Sbjct: 339 KKVNWLCTTPSDSENLVVCDTSKIVKVYTV 368 >ref|XP_017234793.1| PREDICTED: WD repeat-containing protein 53 [Daucus carota subsp. sativus] gb|KZN04349.1| hypothetical protein DCAR_005186 [Daucus carota subsp. sativus] Length = 375 Score = 61.6 bits (148), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 +KVNWLCTTPSDSENLIVCDTSK +KVYT+ Sbjct: 345 RKVNWLCTTPSDSENLIVCDTSKLVKVYTI 374 >ref|XP_020097558.1| WD repeat-containing protein 53 [Ananas comosus] Length = 373 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNW+CT+P+DSENLIVCDTSK LKVYTV Sbjct: 343 KKVNWICTSPTDSENLIVCDTSKVLKVYTV 372 >ref|XP_009408896.1| PREDICTED: WD repeat-containing protein 53 [Musa acuminata subsp. malaccensis] Length = 400 Score = 61.2 bits (147), Expect = 2e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 +KVNWLCTTP+DSENL+VCDTSK LK+YTV Sbjct: 370 RKVNWLCTTPTDSENLVVCDTSKILKIYTV 399 >gb|OAY84422.1| WD repeat-containing protein 53, partial [Ananas comosus] Length = 434 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNW+CT+P+DSENLIVCDTSK LKVYTV Sbjct: 404 KKVNWICTSPTDSENLIVCDTSKVLKVYTV 433 >gb|KMT04435.1| hypothetical protein BVRB_8g181100 isoform A [Beta vulgaris subsp. vulgaris] Length = 375 Score = 60.8 bits (146), Expect = 3e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNWLCTTP+DSENL+VCDTSK +KVYT+ Sbjct: 345 KKVNWLCTTPTDSENLVVCDTSKVVKVYTL 374 >ref|XP_015621750.1| PREDICTED: WD repeat-containing protein 53 isoform X2 [Oryza sativa Japonica Group] dbj|BAD72990.1| putative G-protein beta [Oryza sativa Japonica Group] dbj|BAF04250.1| Os01g0205100 [Oryza sativa Japonica Group] dbj|BAH00742.1| unnamed protein product [Oryza sativa Japonica Group] gb|EEC70135.1| hypothetical protein OsI_00819 [Oryza sativa Indica Group] dbj|BAS70936.1| Os01g0205100 [Oryza sativa Japonica Group] Length = 381 Score = 60.8 bits (146), Expect = 3e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTVP 140 KKVNWLCTTP+DS+NLIVCDTSK +KVY +P Sbjct: 351 KKVNWLCTTPTDSDNLIVCDTSKVVKVYNLP 381 >gb|KMT04436.1| hypothetical protein BVRB_8g181100 isoform B [Beta vulgaris subsp. vulgaris] Length = 384 Score = 60.8 bits (146), Expect = 3e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNWLCTTP+DSENL+VCDTSK +KVYT+ Sbjct: 354 KKVNWLCTTPTDSENLVVCDTSKVVKVYTL 383 >ref|XP_022012044.1| WD repeat-containing protein 53 [Helianthus annuus] gb|OTF95226.1| putative transducin/WD40 repeat-like superfamily protein [Helianthus annuus] Length = 388 Score = 60.8 bits (146), Expect = 3e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 +KVNWLCTTP+DSENL+VCDTSK +KVYTV Sbjct: 358 RKVNWLCTTPTDSENLVVCDTSKVVKVYTV 387 >ref|XP_015621749.1| PREDICTED: WD repeat-containing protein 53 isoform X1 [Oryza sativa Japonica Group] Length = 389 Score = 60.8 bits (146), Expect = 3e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTVP 140 KKVNWLCTTP+DS+NLIVCDTSK +KVY +P Sbjct: 359 KKVNWLCTTPTDSDNLIVCDTSKVVKVYNLP 389 >ref|XP_010686462.1| PREDICTED: cellulose synthase A catalytic subunit 8 [UDP-forming] [Beta vulgaris subsp. vulgaris] Length = 1424 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNWLCTTP+DSENL+VCDTSK +KVYT+ Sbjct: 345 KKVNWLCTTPTDSENLVVCDTSKVVKVYTL 374 >ref|XP_022140168.1| cellulose synthase A catalytic subunit 8 [UDP-forming] [Momordica charantia] Length = 1453 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNWLCTTPS++ENLIVCDTSK +KVYTV Sbjct: 343 KKVNWLCTTPSETENLIVCDTSKVVKVYTV 372 >ref|XP_020517775.1| WD repeat-containing protein 53 isoform X3 [Amborella trichopoda] Length = 328 Score = 60.5 bits (145), Expect = 4e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNWLCTTP+DSEN++VCDTSK +KVYTV Sbjct: 298 KKVNWLCTTPNDSENVVVCDTSKIVKVYTV 327 >ref|XP_020517774.1| WD repeat-containing protein 53 isoform X2 [Amborella trichopoda] Length = 343 Score = 60.5 bits (145), Expect = 4e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 48 KKVNWLCTTPSDSENLIVCDTSKALKVYTV 137 KKVNWLCTTP+DSEN++VCDTSK +KVYTV Sbjct: 313 KKVNWLCTTPNDSENVVVCDTSKIVKVYTV 342