BLASTX nr result
ID: Ophiopogon22_contig00031598
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00031598 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AMM04380.1| UDP-D-apiose/UDP-D-xylose synthase [Ornithogalum ... 60 1e-08 gb|PLY65220.1| hypothetical protein LSAT_8X14120 [Lactuca sativa] 60 3e-08 ref|XP_018483396.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 61 3e-08 ref|XP_018486173.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 61 3e-08 ref|XP_009148080.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 61 3e-08 ref|XP_018451604.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 61 3e-08 ref|XP_009110904.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 61 3e-08 ref|XP_013657587.1| UDP-D-apiose/UDP-D-xylose synthase 2 [Brassi... 61 3e-08 ref|XP_013605833.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 61 3e-08 gb|KRH25153.1| hypothetical protein GLYMA_12G084100 [Glycine max] 61 4e-08 ref|XP_006592299.2| PREDICTED: LOW QUALITY PROTEIN: UDP-D-apiose... 61 4e-08 gb|KHN38679.1| Bifunctional polymyxin resistance protein ArnA [G... 61 4e-08 gb|PLY70663.1| hypothetical protein LSAT_5X34360 [Lactuca sativa] 60 6e-08 ref|XP_015935869.1| UDP-D-apiose/UDP-D-xylose synthase 2 [Arachi... 60 6e-08 ref|XP_018485456.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 60 6e-08 ref|XP_009118389.1| PREDICTED: LOW QUALITY PROTEIN: UDP-D-apiose... 60 6e-08 ref|XP_013605890.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 60 6e-08 gb|KVH90639.1| NAD-dependent epimerase/dehydratase, partial [Cyn... 60 6e-08 gb|KMZ71282.1| Bifunctional polymyxin resistance arnA protein [Z... 55 6e-08 ref|XP_023758715.1| UDP-D-apiose/UDP-D-xylose synthase 2-like [L... 60 7e-08 >gb|AMM04380.1| UDP-D-apiose/UDP-D-xylose synthase [Ornithogalum longebracteatum] Length = 393 Score = 59.7 bits (143), Expect(2) = 1e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L L+ ETPHTVLALDVYNDK Sbjct: 17 ICMIGAGGFIGSHLCEKLMMETPHTVLALDVYNDK 51 Score = 26.9 bits (58), Expect(2) = 1e-08 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 189 QIRHLLDDDDSGAGQKQSSYGRIQ 118 +IRHLLD D G+ + GRIQ Sbjct: 51 KIRHLLDADGDGSSNRHPWSGRIQ 74 >gb|PLY65220.1| hypothetical protein LSAT_8X14120 [Lactuca sativa] Length = 204 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L LL ETPHTVLA+DVYNDK Sbjct: 20 ICMIGAGGFIGSHLCEKLLTETPHTVLAVDVYNDK 54 >ref|XP_018483396.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase 1 [Raphanus sativus] Length = 389 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L LLNETPH VLALDVYNDK Sbjct: 20 ICMIGAGGFIGSHLCEKLLNETPHKVLALDVYNDK 54 >ref|XP_018486173.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase 2-like [Raphanus sativus] Length = 389 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L LLNETPH VLALDVYNDK Sbjct: 20 ICMIGAGGFIGSHLCEKLLNETPHKVLALDVYNDK 54 >ref|XP_009148080.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase 2-like [Brassica rapa] Length = 389 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L LLNETPH VLALDVYNDK Sbjct: 20 ICMIGAGGFIGSHLCEKLLNETPHKVLALDVYNDK 54 >ref|XP_018451604.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase 2-like [Raphanus sativus] Length = 390 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L LLNETPH VLALDVYNDK Sbjct: 21 ICMIGAGGFIGSHLCEKLLNETPHKVLALDVYNDK 55 >ref|XP_009110904.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase 2-like [Brassica rapa] Length = 390 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L LLNETPH VLALDVYNDK Sbjct: 21 ICMIGAGGFIGSHLCEKLLNETPHKVLALDVYNDK 55 >ref|XP_013657587.1| UDP-D-apiose/UDP-D-xylose synthase 2 [Brassica napus] emb|CDY31160.1| BnaA08g27100D [Brassica napus] Length = 390 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L LLNETPH VLALDVYNDK Sbjct: 21 ICMIGAGGFIGSHLCEKLLNETPHKVLALDVYNDK 55 >ref|XP_013605833.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase 2-like [Brassica oleracea var. oleracea] ref|XP_013729524.1| UDP-D-apiose/UDP-D-xylose synthase 2 [Brassica napus] emb|CDY32824.1| BnaC08g02460D [Brassica napus] Length = 390 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L LLNETPH VLALDVYNDK Sbjct: 21 ICMIGAGGFIGSHLCEKLLNETPHKVLALDVYNDK 55 >gb|KRH25153.1| hypothetical protein GLYMA_12G084100 [Glycine max] Length = 340 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L L++ETPHTVLALDVYNDK Sbjct: 16 ICMIGAGGFIGSHLCEKLMSETPHTVLALDVYNDK 50 >ref|XP_006592299.2| PREDICTED: LOW QUALITY PROTEIN: UDP-D-apiose/UDP-D-xylose synthase 2 [Glycine max] Length = 385 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L L++ETPHTVLALDVYNDK Sbjct: 16 ICMIGAGGFIGSHLCEKLMSETPHTVLALDVYNDK 50 >gb|KHN38679.1| Bifunctional polymyxin resistance protein ArnA [Glycine soja] Length = 385 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L L++ETPHTVLALDVYNDK Sbjct: 16 ICMIGAGGFIGSHLCEKLMSETPHTVLALDVYNDK 50 >gb|PLY70663.1| hypothetical protein LSAT_5X34360 [Lactuca sativa] Length = 277 Score = 60.1 bits (144), Expect = 6e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L LL ETPHTVLA+DVYNDK Sbjct: 20 ICMIGAGGFIGSHLCEKLLTETPHTVLAVDVYNDK 54 >ref|XP_015935869.1| UDP-D-apiose/UDP-D-xylose synthase 2 [Arachis duranensis] ref|XP_016170578.1| UDP-D-apiose/UDP-D-xylose synthase 2 [Arachis ipaensis] Length = 387 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L L+ ETPHTVLALDVYNDK Sbjct: 18 ICMIGAGGFIGSHLCEKLMTETPHTVLALDVYNDK 52 >ref|XP_018485456.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase 2 [Raphanus sativus] Length = 389 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L L+NETPH VLALDVYNDK Sbjct: 20 ICMIGAGGFIGSHLCEKLMNETPHKVLALDVYNDK 54 >ref|XP_009118389.1| PREDICTED: LOW QUALITY PROTEIN: UDP-D-apiose/UDP-D-xylose synthase 2-like [Brassica rapa] Length = 389 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L L+NETPH VLALDVYNDK Sbjct: 20 ICMIGAGGFIGSHLCEKLMNETPHKVLALDVYNDK 54 >ref|XP_013605890.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase 2 [Brassica oleracea var. oleracea] ref|XP_013716519.1| UDP-D-apiose/UDP-D-xylose synthase 2 [Brassica napus] emb|CDY22696.1| BnaC08g43300D [Brassica napus] Length = 389 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L L+NETPH VLALDVYNDK Sbjct: 20 ICMIGAGGFIGSHLCEKLMNETPHKVLALDVYNDK 54 >gb|KVH90639.1| NAD-dependent epimerase/dehydratase, partial [Cynara cardunculus var. scolymus] Length = 450 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L LL+ETPHTVLA+DVYNDK Sbjct: 68 ICMIGAGGFIGSHLCEKLLSETPHTVLAVDVYNDK 102 >gb|KMZ71282.1| Bifunctional polymyxin resistance arnA protein [Zostera marina] Length = 390 Score = 55.5 bits (132), Expect(2) = 6e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L LL ET HT+LA+DVYNDK Sbjct: 17 ICMIGAGGFIGSHLCEKLLFETSHTILAVDVYNDK 51 Score = 28.9 bits (63), Expect(2) = 6e-08 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 189 QIRHLLDDDDSGAGQKQSSYGRIQ 118 +I HLLD +SG+G K GRIQ Sbjct: 51 KINHLLDHPESGSGSKHPWSGRIQ 74 >ref|XP_023758715.1| UDP-D-apiose/UDP-D-xylose synthase 2-like [Lactuca sativa] ref|XP_023739715.1| UDP-D-apiose/UDP-D-xylose synthase 2-like [Lactuca sativa] Length = 317 Score = 60.1 bits (144), Expect = 7e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 290 ICMIGAGGFIGKNLRVDLLNETPHTVLALDVYNDK 186 ICMIGAGGFIG +L LL ETPHTVLA+DVYNDK Sbjct: 20 ICMIGAGGFIGSHLCEKLLTETPHTVLAVDVYNDK 54