BLASTX nr result
ID: Ophiopogon22_contig00030345
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00030345 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257347.1| pentatricopeptide repeat-containing protein ... 102 1e-22 gb|OVA13735.1| Pentatricopeptide repeat [Macleaya cordata] 91 7e-19 gb|EOY14282.1| Tetratricopeptide repeat (TPR)-like superfamily p... 91 9e-19 ref|XP_022724668.1| pentatricopeptide repeat-containing protein ... 86 4e-17 ref|XP_010926234.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-17 ref|XP_022724665.1| pentatricopeptide repeat-containing protein ... 86 4e-17 ref|XP_021299496.1| pentatricopeptide repeat-containing protein ... 85 1e-16 ref|XP_020586696.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 84 2e-16 ref|XP_017696766.1| PREDICTED: pentatricopeptide repeat-containi... 83 5e-16 gb|PIA65627.1| hypothetical protein AQUCO_00100855v1 [Aquilegia ... 83 5e-16 gb|PON86633.1| Tetratricopeptide-like helical domain containing ... 82 8e-16 ref|XP_020698794.1| pentatricopeptide repeat-containing protein ... 82 1e-15 ref|XP_021801507.1| pentatricopeptide repeat-containing protein ... 81 2e-15 ref|XP_008222705.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-15 ref|XP_021831801.1| pentatricopeptide repeat-containing protein ... 80 4e-15 gb|PON52589.1| Tetratricopeptide-like helical domain containing ... 80 5e-15 gb|PKA49090.1| Pentatricopeptide repeat-containing protein [Apos... 80 5e-15 gb|OMO82019.1| hypothetical protein CCACVL1_12113 [Corchorus cap... 80 7e-15 ref|XP_007222047.2| pentatricopeptide repeat-containing protein ... 80 7e-15 ref|XP_010261135.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-14 >ref|XP_020257347.1| pentatricopeptide repeat-containing protein At4g19191, mitochondrial [Asparagus officinalis] Length = 648 Score = 102 bits (253), Expect = 1e-22 Identities = 49/65 (75%), Positives = 55/65 (84%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLKV 188 WE VAK+ AMMKREGV+KLPGQSI+QV+G+ HVFTVEDRSHPEG LIY LDGLAL LK Sbjct: 579 WEGVAKVRAMMKREGVNKLPGQSIIQVDGRGHVFTVEDRSHPEGLLIYDTLDGLALHLKE 638 Query: 187 KGQPR 173 K + R Sbjct: 639 KDRQR 643 >gb|OVA13735.1| Pentatricopeptide repeat [Macleaya cordata] Length = 654 Score = 91.3 bits (225), Expect = 7e-19 Identities = 45/62 (72%), Positives = 50/62 (80%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLKV 188 WESVAKI +MMK V K PGQS+VQVNGK+H FTVEDR HPEG LIY +LDGLALQL Sbjct: 579 WESVAKIRSMMKCNRVRKSPGQSLVQVNGKSHAFTVEDRCHPEGLLIYEVLDGLALQLTK 638 Query: 187 KG 182 +G Sbjct: 639 EG 640 >gb|EOY14282.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gb|EOY14283.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gb|EOY14284.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 653 Score = 90.9 bits (224), Expect = 9e-19 Identities = 45/64 (70%), Positives = 49/64 (76%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLKV 188 W+ VA I +MKR VSK PGQS+VQVNGK H FTVEDRSHPEG LIY +LD LALQLK Sbjct: 578 WDEVAMIRLLMKRNNVSKSPGQSLVQVNGKTHRFTVEDRSHPEGVLIYTLLDDLALQLKD 637 Query: 187 KGQP 176 G P Sbjct: 638 DGYP 641 >ref|XP_022724668.1| pentatricopeptide repeat-containing protein At4g19191, mitochondrial isoform X2 [Durio zibethinus] Length = 572 Score = 86.3 bits (212), Expect = 4e-17 Identities = 44/69 (63%), Positives = 49/69 (71%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLKV 188 W+ VA I +MK VSK PGQS+VQVNGK H FTVEDRSHPEG LIY +LD LALQLK Sbjct: 497 WDEVAMIRLLMKHNNVSKSPGQSLVQVNGKTHRFTVEDRSHPEGVLIYALLDYLALQLKD 556 Query: 187 KGQPRGILD 161 P + D Sbjct: 557 DRYPLYLRD 565 >ref|XP_010926234.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial [Elaeis guineensis] Length = 651 Score = 86.3 bits (212), Expect = 4e-17 Identities = 40/62 (64%), Positives = 49/62 (79%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLKV 188 WE VAK+ MMK++G+ K PG+SIVQVNG+ H+FTVEDR+HPEG IY +LD LAL LK Sbjct: 576 WEGVAKLRVMMKQKGIRKSPGRSIVQVNGRFHIFTVEDRTHPEGLQIYEVLDNLALLLKE 635 Query: 187 KG 182 G Sbjct: 636 AG 637 >ref|XP_022724665.1| pentatricopeptide repeat-containing protein At4g19191, mitochondrial isoform X1 [Durio zibethinus] ref|XP_022724666.1| pentatricopeptide repeat-containing protein At4g19191, mitochondrial isoform X1 [Durio zibethinus] Length = 652 Score = 86.3 bits (212), Expect = 4e-17 Identities = 44/69 (63%), Positives = 49/69 (71%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLKV 188 W+ VA I +MK VSK PGQS+VQVNGK H FTVEDRSHPEG LIY +LD LALQLK Sbjct: 577 WDEVAMIRLLMKHNNVSKSPGQSLVQVNGKTHRFTVEDRSHPEGVLIYALLDYLALQLKD 636 Query: 187 KGQPRGILD 161 P + D Sbjct: 637 DRYPLYLRD 645 >ref|XP_021299496.1| pentatricopeptide repeat-containing protein At4g19191, mitochondrial [Herrania umbratica] Length = 653 Score = 85.1 bits (209), Expect = 1e-16 Identities = 43/64 (67%), Positives = 47/64 (73%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLKV 188 W+ VA I +MKR VSK PGQS+VQVNGK FTVEDRSHPE LIY +LD LALQLK Sbjct: 578 WDEVAMIRLLMKRSNVSKSPGQSLVQVNGKTRRFTVEDRSHPESVLIYMLLDDLALQLKD 637 Query: 187 KGQP 176 G P Sbjct: 638 DGYP 641 >ref|XP_020586696.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g19191, mitochondrial-like [Phalaenopsis equestris] Length = 665 Score = 84.3 bits (207), Expect = 2e-16 Identities = 40/68 (58%), Positives = 51/68 (75%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLKV 188 WE VAK+ MM+R+G+ K GQSIVQVNGKAH F V+DR HP+GS+IY +LD L+ LKV Sbjct: 595 WEGVAKVRVMMRRKGLKKSAGQSIVQVNGKAHSFFVDDRVHPDGSIIYEVLDCLSFHLKV 654 Query: 187 KGQPRGIL 164 + Q +L Sbjct: 655 EQQMEDLL 662 >ref|XP_017696766.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial [Phoenix dactylifera] Length = 651 Score = 83.2 bits (204), Expect = 5e-16 Identities = 39/62 (62%), Positives = 47/62 (75%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLKV 188 WE AK+ MMK++G+ KLPG+SIVQVN K H+FTVEDR+HPEG IY +LD L L LK Sbjct: 576 WEGAAKLRMMMKQKGIRKLPGRSIVQVNRKFHIFTVEDRTHPEGLQIYEVLDNLDLHLKE 635 Query: 187 KG 182 G Sbjct: 636 AG 637 >gb|PIA65627.1| hypothetical protein AQUCO_00100855v1 [Aquilegia coerulea] Length = 658 Score = 83.2 bits (204), Expect = 5e-16 Identities = 40/59 (67%), Positives = 45/59 (76%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLK 191 WE+VAK+ AMMK + K PGQS V+ NGK H FTVEDRSHPEG LIY +LDGLAL K Sbjct: 587 WENVAKVRAMMKGNRLRKSPGQSSVEANGKIHSFTVEDRSHPEGLLIYEVLDGLALHFK 645 >gb|PON86633.1| Tetratricopeptide-like helical domain containing protein [Trema orientalis] Length = 639 Score = 82.4 bits (202), Expect = 8e-16 Identities = 40/59 (67%), Positives = 43/59 (72%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLK 191 W+ VA I MMK V K PGQSI+QVNGK HVF VEDR HPEG LIY +LD L LQLK Sbjct: 579 WDGVAAIRKMMKSNKVKKFPGQSIIQVNGKPHVFAVEDRGHPEGLLIYEMLDSLILQLK 637 >ref|XP_020698794.1| pentatricopeptide repeat-containing protein At4g19191, mitochondrial [Dendrobium catenatum] gb|PKU86272.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 649 Score = 82.0 bits (201), Expect = 1e-15 Identities = 37/61 (60%), Positives = 47/61 (77%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLKV 188 WE VAK+ AMM+R+G+ K GQSIVQVNGK H F V+DR HPEGS++Y +LD L LK+ Sbjct: 579 WEGVAKVRAMMRRKGLKKSGGQSIVQVNGKGHSFFVDDRVHPEGSIVYEVLDSLGFHLKM 638 Query: 187 K 185 + Sbjct: 639 E 639 >ref|XP_021801507.1| pentatricopeptide repeat-containing protein At4g19191, mitochondrial-like [Prunus avium] Length = 640 Score = 81.3 bits (199), Expect = 2e-15 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLK 191 W+ VA + MK + V K+PGQS++ VNGK HVFTVEDR HPEG LIY +LD LALQLK Sbjct: 569 WDEVAALRTAMKFKKVKKIPGQSLLHVNGKPHVFTVEDRGHPEGLLIYAMLDSLALQLK 627 >ref|XP_008222705.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial [Prunus mume] Length = 640 Score = 81.3 bits (199), Expect = 2e-15 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLK 191 W+ VA + MK + V K+PGQS++ VNGK HVFTVEDR HPEG LIY +LD LALQLK Sbjct: 569 WDEVAALRTAMKFKKVKKIPGQSLLHVNGKPHVFTVEDRGHPEGLLIYAMLDSLALQLK 627 >ref|XP_021831801.1| pentatricopeptide repeat-containing protein At4g19191, mitochondrial-like [Prunus avium] Length = 640 Score = 80.5 bits (197), Expect = 4e-15 Identities = 38/59 (64%), Positives = 44/59 (74%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLK 191 W+ VA + MK + V K PGQS++ VNGK HVFTVEDR HPEG LIY +LD LALQLK Sbjct: 569 WDEVAALRTAMKFKKVKKFPGQSLLHVNGKRHVFTVEDRGHPEGLLIYAMLDSLALQLK 627 >gb|PON52589.1| Tetratricopeptide-like helical domain containing protein [Parasponia andersonii] Length = 639 Score = 80.1 bits (196), Expect = 5e-15 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLK 191 W+ VA I MMK V K PGQSI+QVNGK HVF VED HPEG LIY +LD L LQLK Sbjct: 579 WDGVAAIRKMMKSNKVKKFPGQSIIQVNGKPHVFAVEDSGHPEGLLIYKMLDSLILQLK 637 >gb|PKA49090.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 668 Score = 80.1 bits (196), Expect = 5e-15 Identities = 38/59 (64%), Positives = 46/59 (77%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLK 191 W+ VA++ MM+R+ + K GQSIVQVNGKAH FTVEDR HPEGS IYG+LD L L +K Sbjct: 579 WDGVAELRMMMRRKKLKKAAGQSIVQVNGKAHGFTVEDRVHPEGSNIYGVLDCLTLHMK 637 >gb|OMO82019.1| hypothetical protein CCACVL1_12113 [Corchorus capsularis] Length = 556 Score = 79.7 bits (195), Expect = 7e-15 Identities = 38/71 (53%), Positives = 50/71 (70%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLKV 188 W+ AKI ++MKR VSK PG+S++Q+N K H FTVED SHPEG LI+ +L+ L LQLK Sbjct: 481 WDGFAKIRSLMKRNNVSKYPGESLIQINKKTHRFTVEDGSHPEGVLIFPLLNNLTLQLKD 540 Query: 187 KGQPRGILD*F 155 P ++D F Sbjct: 541 GCYPLNLVDIF 551 >ref|XP_007222047.2| pentatricopeptide repeat-containing protein At4g19191, mitochondrial [Prunus persica] gb|ONI29058.1| hypothetical protein PRUPE_1G178100 [Prunus persica] Length = 639 Score = 79.7 bits (195), Expect = 7e-15 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLK 191 W+ VA + MK + V K+PGQS++ VNGK HVFTVEDR HPEG LIY +LD LALQLK Sbjct: 568 WDEVAALRRAMKFKKVKKIPGQSLLHVNGKPHVFTVEDRGHPEGLLIYAMLDCLALQLK 626 >ref|XP_010261135.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial [Nelumbo nucifera] Length = 636 Score = 78.2 bits (191), Expect = 3e-14 Identities = 39/59 (66%), Positives = 43/59 (72%) Frame = -2 Query: 367 WESVAKIWAMMKREGVSKLPGQSIVQVNGKAHVFTVEDRSHPEGSLIYGILDGLALQLK 191 W+ V KI AMMK V K G S+VQVNGK H FTVEDR HPE LIY +LDGLALQL+ Sbjct: 575 WDGVVKIRAMMKCNRVKKSAGCSLVQVNGKIHTFTVEDRCHPEDLLIYEVLDGLALQLR 633