BLASTX nr result
ID: Ophiopogon22_contig00030305
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00030305 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248636.1| translocase of chloroplast 120, chloroplasti... 81 5e-15 gb|PON33202.1| LRR domain containing protein [Trema orientalis] 58 5e-07 >ref|XP_020248636.1| translocase of chloroplast 120, chloroplastic [Asparagus officinalis] gb|ONK57100.1| uncharacterized protein A4U43_C10F16620 [Asparagus officinalis] Length = 1215 Score = 80.9 bits (198), Expect = 5e-15 Identities = 50/112 (44%), Positives = 56/112 (50%), Gaps = 6/112 (5%) Frame = -3 Query: 362 ESAEESK------EENDVFEEAAMDSESFYTPASAPRHGASDSQESFYTPAYGHRASDSQ 201 +S EESK EEND FEEA +D + Sbjct: 52 DSVEESKGSVRGSEENDEFEEAELD----------------------------------R 77 Query: 200 ESFYTPAYRHRASDSQDSQETAFDAVESRDGFDGEDGDNPDREDGNLAGNSN 45 ESFYTPAYRH SDSQD QE FD+VES DG DGEDGDN DRE + +SN Sbjct: 78 ESFYTPAYRHMGSDSQDLQEADFDSVESADGVDGEDGDNQDREAKEVVDSSN 129 >gb|PON33202.1| LRR domain containing protein [Trema orientalis] Length = 752 Score = 57.8 bits (138), Expect = 5e-07 Identities = 33/121 (27%), Positives = 51/121 (42%), Gaps = 14/121 (11%) Frame = +2 Query: 11 PPQKQPLLSQHHSNYPPNSXXXXXXXXXXXXQSHRDSPPHQMPFPANPANQKPC------ 172 P + P++ HS PP + Q + PP P P +P + KP Sbjct: 523 PSDRNPVVLHPHSPPPPQAPTPEHSPSPTPKQPAKSPPPSPKPSPKSPPSPKPSTHSPPP 582 Query: 173 AGKPACRSSPVNPKPGAHTPECKSSLE--------NQKPRDEAPTPACKSSPNPSPPPRT 328 + KP+ +S P PKP +P + Q P +P+P SP+PSPPP++ Sbjct: 583 SPKPSPKSPPPPPKPSTESPPPSPKTDRPTSPPKSKQPPPSPSPSPPPSPSPSPSPPPKS 642 Query: 329 H 331 + Sbjct: 643 Y 643