BLASTX nr result
ID: Ophiopogon22_contig00030293
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00030293 (630 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247666.1| uncharacterized protein LOC109825261 [Aspara... 64 4e-08 >ref|XP_020247666.1| uncharacterized protein LOC109825261 [Asparagus officinalis] ref|XP_020247667.1| uncharacterized protein LOC109825261 [Asparagus officinalis] gb|ONK55771.1| uncharacterized protein A4U43_C10F820 [Asparagus officinalis] Length = 611 Score = 63.5 bits (153), Expect = 4e-08 Identities = 40/104 (38%), Positives = 53/104 (50%), Gaps = 27/104 (25%) Frame = +3 Query: 333 PKSPTFRTLLRHLPXHEPRAAYPAS-------YNPSYLPRSP------------------ 437 P SP+ + + H+ A A+ Y+P Y P SP Sbjct: 65 PYSPSHEPSIPLIAQHDADAPVDANSNQEYNPYSPFYEPHSPIPTMLPEPEELEENEEPL 124 Query: 438 -SYIPLDPQEATDDPLSVSPLRTVSPLVRPYIPPFL-QDVSMYA 563 SYIPLD +E DDPLSV PLRT+SPL+RPY PF+ +D+ MY+ Sbjct: 125 ESYIPLDLEEGNDDPLSVYPLRTMSPLLRPYANPFVRRDIPMYS 168