BLASTX nr result
ID: Ophiopogon22_contig00030147
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00030147 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010255062.1| PREDICTED: B3 domain-containing protein REM1... 56 3e-06 ref|XP_010089922.1| B3 domain-containing protein REM16 [Morus no... 56 3e-06 >ref|XP_010255062.1| PREDICTED: B3 domain-containing protein REM16-like [Nelumbo nucifera] Length = 397 Score = 56.2 bits (134), Expect = 3e-06 Identities = 37/92 (40%), Positives = 49/92 (53%), Gaps = 1/92 (1%) Frame = -3 Query: 273 NATSVGHKRKTRTETIWGSLNKIAERHIEKGDSSLHPCENPTYLIQLISSRRPVTDTEKD 94 +AT + KRK + E E GD L N + I +S RRPVT+ E Sbjct: 201 SATPLPAKRKPKRE----------EPADYSGDEELSESLNRAFHIHFLSKRRPVTEVEML 250 Query: 93 RAFELAS-AMELANPSFQAVMKTTHVYKRFFL 1 R ELA+ A+ L+ SF+ VM+ THVYKRF+L Sbjct: 251 RTLELANEALVLSETSFKIVMQPTHVYKRFYL 282 >ref|XP_010089922.1| B3 domain-containing protein REM16 [Morus notabilis] ref|XP_024017087.1| B3 domain-containing protein REM16 [Morus notabilis] gb|EXB38618.1| B3 domain-containing protein REM16 [Morus notabilis] Length = 404 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 2/66 (3%) Frame = -3 Query: 192 IEKGDSSLHPCENPTYLIQLISSRRPVTDTEKDRAFELASA--MELANPSFQAVMKTTHV 19 + K D+ P Y +Q +S+RRP+T+ EKDRA +LA A E N VMK T+V Sbjct: 220 VTKSDAEHTPTRRRGYSMQYVSNRRPITEDEKDRAMKLAEAEISESNNEGLLVVMKPTYV 279 Query: 18 YKRFFL 1 YKRF++ Sbjct: 280 YKRFYV 285