BLASTX nr result
ID: Ophiopogon22_contig00030025
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00030025 (603 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020773096.1| proline-rich 33 kDa extensin-related protein... 56 6e-06 >ref|XP_020773096.1| proline-rich 33 kDa extensin-related protein-like [Boleophthalmus pectinirostris] Length = 273 Score = 56.2 bits (134), Expect = 6e-06 Identities = 27/89 (30%), Positives = 39/89 (43%) Frame = +3 Query: 255 HPTLNSSPPSHQIHTTSKLQIHHTNTTPPLQAHNSNLHKRNHSSTPQPLHHHTAKSIMAT 434 H ++PP H TT+ HH TT H+ + + + + P P H HT + Sbjct: 86 HQCTTNTPPMHHQRTTNASATHHQRTTNAPPTHHKHTTRPTYGNHPLPTHQHTTNTPTRH 145 Query: 435 TESTRTSPPFQKQHNPDTNPIPNSSQHPT 521 + T +PP H DT P + QHPT Sbjct: 146 QQDTNNTPP---THQQDTTNTPPTHQHPT 171