BLASTX nr result
ID: Ophiopogon22_contig00029996
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00029996 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261780.1| uncharacterized protein LOC109837825 isoform... 58 1e-06 >ref|XP_020261780.1| uncharacterized protein LOC109837825 isoform X1 [Asparagus officinalis] ref|XP_020261781.1| uncharacterized protein LOC109837825 isoform X2 [Asparagus officinalis] ref|XP_020261782.1| uncharacterized protein LOC109837825 isoform X1 [Asparagus officinalis] gb|ONK72852.1| uncharacterized protein A4U43_C04F24040 [Asparagus officinalis] Length = 783 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +2 Query: 2 QIFEAMENFTANSFKDYEELHVHSEEEKAVSEHAKSSG 115 QIFEA+ENF ANSFK YEELH+ SEEEK E+ K SG Sbjct: 746 QIFEALENFAANSFKAYEELHIRSEEEKVAWENTKLSG 783