BLASTX nr result
ID: Ophiopogon22_contig00029961
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00029961 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN38584.1| Vacuolar protein sorting-associated protein 26B, ... 99 8e-24 gb|KRG89789.1| hypothetical protein GLYMA_20G048500 [Glycine max] 99 5e-23 gb|PKI73277.1| hypothetical protein CRG98_006215 [Punica granatum] 97 7e-23 ref|XP_006836425.1| vacuolar protein sorting-associated protein ... 100 1e-22 ref|XP_021663309.1| vacuolar protein sorting-associated protein ... 100 2e-22 ref|XP_021645941.1| vacuolar protein sorting-associated protein ... 100 2e-22 gb|PON81217.1| Vacuolar protein sorting protein 26 related [Trem... 100 3e-22 gb|PON72006.1| Vacuolar protein sorting protein 26 related [Para... 100 3e-22 gb|OAY57898.1| hypothetical protein MANES_02G133700 [Manihot esc... 97 4e-22 ref|XP_007146203.1| hypothetical protein PHAVU_006G021100g [Phas... 95 4e-22 ref|XP_015873326.1| PREDICTED: vacuolar protein sorting-associat... 99 5e-22 ref|XP_012075978.1| vacuolar protein sorting-associated protein ... 99 5e-22 gb|KHG12074.1| Vacuolar sorting-associated protein 26A -like pro... 98 6e-22 gb|POE59940.1| vacuolar protein sorting-associated protein 26a [... 98 7e-22 ref|XP_020275081.1| vacuolar protein sorting-associated protein ... 99 7e-22 ref|XP_021627446.1| vacuolar protein sorting-associated protein ... 99 7e-22 ref|XP_010251731.1| PREDICTED: vacuolar protein sorting-associat... 99 7e-22 gb|EEF46730.1| vacuolar protein sorting 26, vps26, putative [Ric... 99 7e-22 ref|XP_002532583.1| PREDICTED: vacuolar protein sorting-associat... 99 7e-22 ref|XP_006441185.1| vacuolar protein sorting-associated protein ... 99 7e-22 >gb|KHN38584.1| Vacuolar protein sorting-associated protein 26B, partial [Glycine soja] Length = 106 Score = 98.6 bits (244), Expect = 8e-24 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPTYRNINNKFSVKY+LNLVLVDEEDRRYFKQQEITVYRL +N Sbjct: 57 LSPYELTPTYRNINNKFSVKYFLNLVLVDEEDRRYFKQQEITVYRLSEN 105 >gb|KRG89789.1| hypothetical protein GLYMA_20G048500 [Glycine max] Length = 174 Score = 98.6 bits (244), Expect = 5e-23 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPTYRNINNKFSVKY+LNLVLVDEEDRRYFKQQEITVYRL +N Sbjct: 125 LSPYELTPTYRNINNKFSVKYFLNLVLVDEEDRRYFKQQEITVYRLSEN 173 >gb|PKI73277.1| hypothetical protein CRG98_006215 [Punica granatum] Length = 136 Score = 97.1 bits (240), Expect = 7e-23 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRL 328 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRL Sbjct: 87 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRL 132 >ref|XP_006836425.1| vacuolar protein sorting-associated protein 26B [Amborella trichopoda] ref|XP_011620800.1| vacuolar protein sorting-associated protein 26B [Amborella trichopoda] ref|XP_011620801.1| vacuolar protein sorting-associated protein 26B [Amborella trichopoda] ref|XP_011620802.1| vacuolar protein sorting-associated protein 26B [Amborella trichopoda] ref|XP_011620804.1| vacuolar protein sorting-associated protein 26B [Amborella trichopoda] ref|XP_020518651.1| vacuolar protein sorting-associated protein 26B [Amborella trichopoda] ref|XP_020518652.1| vacuolar protein sorting-associated protein 26B [Amborella trichopoda] ref|XP_020518653.1| vacuolar protein sorting-associated protein 26B [Amborella trichopoda] ref|XP_020518654.1| vacuolar protein sorting-associated protein 26B [Amborella trichopoda] gb|ERM99278.1| hypothetical protein AMTR_s00092p00158340 [Amborella trichopoda] Length = 301 Score = 100 bits (250), Expect = 1e-22 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRL++N Sbjct: 252 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLQEN 300 >ref|XP_021663309.1| vacuolar protein sorting-associated protein 26A [Hevea brasiliensis] Length = 301 Score = 100 bits (248), Expect = 2e-22 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPT+RNINNKFSVKYYLNLVLVDEEDRRYFKQQEIT+YRL+DN Sbjct: 252 LSPYELTPTHRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITIYRLQDN 300 >ref|XP_021645941.1| vacuolar protein sorting-associated protein 26A-like [Hevea brasiliensis] ref|XP_021645942.1| vacuolar protein sorting-associated protein 26A-like [Hevea brasiliensis] Length = 301 Score = 100 bits (248), Expect = 2e-22 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPT+RNINNKFSVKYYLNLVLVDEEDRRYFKQQEIT+YRL+DN Sbjct: 252 LSPYELTPTHRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITIYRLQDN 300 >gb|PON81217.1| Vacuolar protein sorting protein 26 related [Trema orientalis] Length = 301 Score = 99.8 bits (247), Expect = 3e-22 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPT+RNINNKFSVKYYLNLVLVDEEDRRYFKQQEIT+YRLE+N Sbjct: 252 LSPYELTPTHRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITIYRLEEN 300 >gb|PON72006.1| Vacuolar protein sorting protein 26 related [Parasponia andersonii] Length = 301 Score = 99.8 bits (247), Expect = 3e-22 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPT+RNINNKFSVKYYLNLVLVDEEDRRYFKQQEIT+YRLE+N Sbjct: 252 LSPYELTPTHRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITIYRLEEN 300 >gb|OAY57898.1| hypothetical protein MANES_02G133700 [Manihot esculenta] Length = 222 Score = 97.4 bits (241), Expect = 4e-22 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPTYRNINNKFSVKY+LNLVLVDEEDRRYFKQQEITVYRL +N Sbjct: 173 LSPYELTPTYRNINNKFSVKYFLNLVLVDEEDRRYFKQQEITVYRLLEN 221 >ref|XP_007146203.1| hypothetical protein PHAVU_006G021100g [Phaseolus vulgaris] gb|ESW18197.1| hypothetical protein PHAVU_006G021100g [Phaseolus vulgaris] Length = 138 Score = 95.1 bits (235), Expect = 4e-22 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 L PYELTPTY NINNKFSVKY+LNLVLVDEEDRRYFKQQEITVYRL +N Sbjct: 89 LGPYELTPTYHNINNKFSVKYFLNLVLVDEEDRRYFKQQEITVYRLSEN 137 >ref|XP_015873326.1| PREDICTED: vacuolar protein sorting-associated protein 26A-like [Ziziphus jujuba] Length = 299 Score = 99.0 bits (245), Expect = 5e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLE 325 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLE Sbjct: 252 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLE 298 >ref|XP_012075978.1| vacuolar protein sorting-associated protein 26A [Jatropha curcas] gb|KDP34514.1| hypothetical protein JCGZ_11064 [Jatropha curcas] Length = 301 Score = 99.0 bits (245), Expect = 5e-22 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRL +N Sbjct: 252 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLLEN 300 >gb|KHG12074.1| Vacuolar sorting-associated protein 26A -like protein [Gossypium arboreum] Length = 272 Score = 98.2 bits (243), Expect = 6e-22 Identities = 45/49 (91%), Positives = 49/49 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPT+RNINNKFSVKYYLNLVLVDEEDRRYFKQQEIT+YRL+D+ Sbjct: 224 LSPYELTPTHRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITIYRLQDS 272 >gb|POE59940.1| vacuolar protein sorting-associated protein 26a [Quercus suber] Length = 277 Score = 98.2 bits (243), Expect = 7e-22 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLED 322 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEIT+YRL++ Sbjct: 227 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITIYRLQE 274 >ref|XP_020275081.1| vacuolar protein sorting-associated protein 26B-like [Asparagus officinalis] ref|XP_020275082.1| vacuolar protein sorting-associated protein 26B-like [Asparagus officinalis] gb|ONK63862.1| uncharacterized protein A4U43_C07F19700 [Asparagus officinalis] Length = 300 Score = 98.6 bits (244), Expect = 7e-22 Identities = 45/49 (91%), Positives = 49/49 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEIT+YRL+++ Sbjct: 252 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITIYRLQES 300 >ref|XP_021627446.1| vacuolar protein sorting-associated protein 26A [Manihot esculenta] ref|XP_021627454.1| vacuolar protein sorting-associated protein 26A [Manihot esculenta] ref|XP_021627462.1| vacuolar protein sorting-associated protein 26A [Manihot esculenta] gb|OAY59522.1| hypothetical protein MANES_01G037600 [Manihot esculenta] Length = 301 Score = 98.6 bits (244), Expect = 7e-22 Identities = 45/49 (91%), Positives = 49/49 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPT+RNINNKFSVKYYLNLVLVDEEDRRYFKQQEIT+YRL++N Sbjct: 252 LSPYELTPTHRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITIYRLQEN 300 >ref|XP_010251731.1| PREDICTED: vacuolar protein sorting-associated protein 26A-like [Nelumbo nucifera] Length = 301 Score = 98.6 bits (244), Expect = 7e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLED 322 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRL++ Sbjct: 252 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLQE 299 >gb|EEF46730.1| vacuolar protein sorting 26, vps26, putative [Ricinus communis] Length = 301 Score = 98.6 bits (244), Expect = 7e-22 Identities = 45/49 (91%), Positives = 49/49 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPT+RNINNKFSVKYYLNLVLVDEEDRRYFKQQEIT+YRL++N Sbjct: 252 LSPYELTPTHRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITIYRLQEN 300 >ref|XP_002532583.1| PREDICTED: vacuolar protein sorting-associated protein 26A [Ricinus communis] gb|EEF29800.1| vacuolar protein sorting 26, vps26, putative [Ricinus communis] Length = 301 Score = 98.6 bits (244), Expect = 7e-22 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEIT+YRL +N Sbjct: 252 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITIYRLLEN 300 >ref|XP_006441185.1| vacuolar protein sorting-associated protein 26A [Citrus clementina] ref|XP_006491958.1| PREDICTED: vacuolar protein sorting-associated protein 26A [Citrus sinensis] gb|ESR54425.1| hypothetical protein CICLE_v10021339mg [Citrus clementina] gb|KDO59682.1| hypothetical protein CISIN_1g022181mg [Citrus sinensis] Length = 301 Score = 98.6 bits (244), Expect = 7e-22 Identities = 45/49 (91%), Positives = 49/49 (100%) Frame = -3 Query: 465 LSPYELTPTYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITVYRLEDN 319 LSPYELTPT+RNINNKFSVKYYLNLVLVDEEDRRYFKQQEIT+YRL++N Sbjct: 252 LSPYELTPTHRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITIYRLQEN 300