BLASTX nr result
ID: Ophiopogon22_contig00029009
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00029009 (430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274237.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 77 8e-14 >ref|XP_020274237.1| F-box/FBD/LRR-repeat protein At1g13570-like [Asparagus officinalis] gb|ONK79327.1| uncharacterized protein A4U43_C01F5240 [Asparagus officinalis] Length = 415 Score = 77.4 bits (189), Expect = 8e-14 Identities = 44/80 (55%), Positives = 57/80 (71%) Frame = +1 Query: 4 VTGCTHLKISAQELVKLTIFEGEISHVHFESTPHLVTAYIKLVAVSDDSSSVNKEGCGIV 183 VTGCTHL ISAQ++VK+ I +G + FESTP L TA IK++ V+ D S V+KE C IV Sbjct: 193 VTGCTHLNISAQKIVKVVI-QGSFHDIRFESTPLLATASIKMLEVAGD-SLVSKEDCRIV 250 Query: 184 KVLGHIPSIHRLLLLDYALQ 243 +VLG PSI++L LL L+ Sbjct: 251 RVLGDTPSIYQLELLGPTLK 270 Score = 57.8 bits (138), Expect = 6e-07 Identities = 31/53 (58%), Positives = 35/53 (66%) Frame = +2 Query: 269 LHILLCLFIYVITPNSFKGFSRLTTLFLQSVTFTDNGLPTFLSLCPHLKVLGL 427 L + C FI P SFKGFSRLT + L V+FTDNGL T +SLCP LK L L Sbjct: 141 LELYRCAFI---PPTSFKGFSRLTVMTLDRVSFTDNGLATLMSLCPLLKELVL 190