BLASTX nr result
ID: Ophiopogon22_contig00028491
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00028491 (505 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AML79274.1| putative LOV domain-containing protein [Maianthem... 67 1e-09 gb|AML77693.1| putative LOV domain-containing protein [Drimia ma... 67 1e-09 gb|AML77798.1| putative LOV domain-containing protein [Ruscus sp... 67 1e-09 gb|AML77308.1| putative LOV domain-containing protein [Nolina at... 67 1e-09 ref|XP_009793164.1| PREDICTED: adagio protein 3, partial [Nicoti... 66 2e-09 gb|AML78955.1| putative LOV domain-containing protein [Disporops... 66 2e-09 gb|AML77600.1| putative LOV domain-containing protein [Aloe vera] 65 3e-09 gb|PAN42996.1| hypothetical protein PAHAL_H02351 [Panicum hallii] 65 5e-09 gb|AML77720.1| putative LOV domain-containing protein [Agave teq... 65 5e-09 gb|AML77909.1| putative LOV domain-containing protein [Lomandra ... 65 5e-09 ref|XP_008668395.1| uncharacterized protein LOC100383277 isoform... 65 5e-09 ref|XP_016449579.1| PREDICTED: adagio protein 3-like, partial [N... 64 7e-09 gb|AML78440.1| putative LOV domain-containing protein [Maianthem... 64 7e-09 dbj|BAT14390.1| Os11g0547000, partial [Oryza sativa Japonica Group] 64 1e-08 gb|APY23904.1| flavin-binding, kelch repeat, f box 1, partial [L... 64 1e-08 ref|XP_010274765.1| PREDICTED: adagio protein 3-like isoform X2 ... 64 1e-08 ref|XP_009409097.1| PREDICTED: adagio-like protein 3 [Musa acumi... 64 1e-08 gb|AML77747.1| putative LOV domain-containing protein [Curcuma s... 64 1e-08 gb|AML76447.1| putative LOV domain-containing protein [Zingiber ... 64 1e-08 gb|AML79462.1| putative LOV domain-containing protein [Curculigo... 64 1e-08 >gb|AML79274.1| putative LOV domain-containing protein [Maianthemum canadense] Length = 586 Score = 66.6 bits (161), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE Sbjct: 59 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 88 >gb|AML77693.1| putative LOV domain-containing protein [Drimia maritima] Length = 629 Score = 66.6 bits (161), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE Sbjct: 102 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 131 >gb|AML77798.1| putative LOV domain-containing protein [Ruscus sp. BC-2016] Length = 631 Score = 66.6 bits (161), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE Sbjct: 104 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 133 >gb|AML77308.1| putative LOV domain-containing protein [Nolina atopocarpa] Length = 640 Score = 66.6 bits (161), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE Sbjct: 109 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 138 >ref|XP_009793164.1| PREDICTED: adagio protein 3, partial [Nicotiana sylvestris] Length = 539 Score = 66.2 bits (160), Expect = 2e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 106 FLPFSRFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 F+ FSRFLQFRDP+AQRRHPLVDP+VVSEI RCLE Sbjct: 1 FICFSRFLQFRDPRAQRRHPLVDPVVVSEIRRCLE 35 >gb|AML78955.1| putative LOV domain-containing protein [Disporopsis pernyi] Length = 619 Score = 65.9 bits (159), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDPQAQRRHPLVDPMVVSEIHRC+E Sbjct: 92 RFLQFRDPQAQRRHPLVDPMVVSEIHRCIE 121 >gb|AML77600.1| putative LOV domain-containing protein [Aloe vera] Length = 581 Score = 65.5 bits (158), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDPQAQRRHPLVDPMVVSEIHRCL+ Sbjct: 56 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLD 85 >gb|PAN42996.1| hypothetical protein PAHAL_H02351 [Panicum hallii] Length = 539 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 103 LPFSRFLQFRDPQAQRRHPLVDPMVVSEIHRCL 5 L FSRFLQFRDP+AQRRHPLVDPM+VSEI RCL Sbjct: 8 LSFSRFLQFRDPRAQRRHPLVDPMIVSEIRRCL 40 >gb|AML77720.1| putative LOV domain-containing protein [Agave tequilana] Length = 584 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDPQA RRHPLVDPMVVSEIHRCLE Sbjct: 57 RFLQFRDPQAHRRHPLVDPMVVSEIHRCLE 86 >gb|AML77909.1| putative LOV domain-containing protein [Lomandra longifolia] Length = 599 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCL 5 RFLQFRDPQAQRRHPLVDPMVVSEIHRCL Sbjct: 75 RFLQFRDPQAQRRHPLVDPMVVSEIHRCL 103 >ref|XP_008668395.1| uncharacterized protein LOC100383277 isoform X1 [Zea mays] Length = 623 Score = 64.7 bits (156), Expect = 5e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 103 LPFSRFLQFRDPQAQRRHPLVDPMVVSEIHRCL 5 L FSRFLQFRDP AQRRHPLVDPMVVSEI RCL Sbjct: 91 LSFSRFLQFRDPHAQRRHPLVDPMVVSEIRRCL 123 >ref|XP_016449579.1| PREDICTED: adagio protein 3-like, partial [Nicotiana tabacum] Length = 538 Score = 64.3 bits (155), Expect = 7e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 97 FSRFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 FSRFLQFRDP+AQRRHPLVDP+VVSEI RCLE Sbjct: 3 FSRFLQFRDPRAQRRHPLVDPVVVSEIRRCLE 34 >gb|AML78440.1| putative LOV domain-containing protein [Maianthemum sp. BC-2016] Length = 633 Score = 64.3 bits (155), Expect = 7e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDPQAQRRHP VDPMVVSEIHRCLE Sbjct: 106 RFLQFRDPQAQRRHPSVDPMVVSEIHRCLE 135 >dbj|BAT14390.1| Os11g0547000, partial [Oryza sativa Japonica Group] Length = 548 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 97 FSRFLQFRDPQAQRRHPLVDPMVVSEIHRCL 5 FSRFLQFRDP+AQRRHPLVDPMVVSEI RCL Sbjct: 19 FSRFLQFRDPRAQRRHPLVDPMVVSEIRRCL 49 >gb|APY23904.1| flavin-binding, kelch repeat, f box 1, partial [Lilium formosanum x Lilium longiflorum] Length = 594 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDP+AQRRHPLVDPMVVSEIH+CLE Sbjct: 66 RFLQFRDPRAQRRHPLVDPMVVSEIHKCLE 95 >ref|XP_010274765.1| PREDICTED: adagio protein 3-like isoform X2 [Nelumbo nucifera] Length = 596 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 124 LIFELPFLPFSRFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 LI EL FL FSRFLQ+RDP+AQRRHPLVDP+V+SEI RCLE Sbjct: 43 LIMEL-FL-FSRFLQYRDPRAQRRHPLVDPVVISEIRRCLE 81 >ref|XP_009409097.1| PREDICTED: adagio-like protein 3 [Musa acuminata subsp. malaccensis] Length = 616 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDP+AQRRHPLVDPMVV+EIHRCLE Sbjct: 90 RFLQFRDPRAQRRHPLVDPMVVAEIHRCLE 119 >gb|AML77747.1| putative LOV domain-containing protein [Curcuma sumatrana] Length = 619 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDP+AQRRHPLVDPMVV+EIHRCLE Sbjct: 92 RFLQFRDPRAQRRHPLVDPMVVAEIHRCLE 121 >gb|AML76447.1| putative LOV domain-containing protein [Zingiber officinale] Length = 619 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDP+AQRRHPLVDPMVV+EIHRCLE Sbjct: 92 RFLQFRDPRAQRRHPLVDPMVVAEIHRCLE 121 >gb|AML79462.1| putative LOV domain-containing protein [Curculigo sp. BC-2016] Length = 621 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 91 RFLQFRDPQAQRRHPLVDPMVVSEIHRCLE 2 RFLQFRDP AQRRHPLVDPMVVSEIHRCLE Sbjct: 95 RFLQFRDPLAQRRHPLVDPMVVSEIHRCLE 124