BLASTX nr result
ID: Ophiopogon22_contig00028466
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00028466 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK77492.1| uncharacterized protein A4U43_C02F7120 [Asparagus... 54 2e-06 >gb|ONK77492.1| uncharacterized protein A4U43_C02F7120 [Asparagus officinalis] Length = 126 Score = 54.3 bits (129), Expect = 2e-06 Identities = 21/40 (52%), Positives = 29/40 (72%) Frame = +3 Query: 285 EINQVELLAAWYALSWCCNKFGQSLIWIEGDSSRVVELQS 404 E+N EL+ AW AL+WC ++G L+WIEGDS V++L S Sbjct: 52 EVNYAELIGAWSALTWCYKRYGACLVWIEGDSKHVLDLLS 91