BLASTX nr result
ID: Ophiopogon22_contig00028380
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00028380 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020277263.1| sulfite reductase [ferredoxin], chloroplasti... 60 2e-07 ref|XP_020258050.1| sulfite reductase [ferredoxin], chloroplasti... 55 5e-06 >ref|XP_020277263.1| sulfite reductase [ferredoxin], chloroplastic-like [Asparagus officinalis] gb|ONK59734.1| uncharacterized protein A4U43_C08F9930 [Asparagus officinalis] Length = 635 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = +1 Query: 310 KDPNVQIHGYGFQGLRSARSIPIGRSVRASPTP 408 KDP VQIHGYGFQGLRS SIPI RSVRASP P Sbjct: 11 KDPKVQIHGYGFQGLRSGGSIPIPRSVRASPAP 43 >ref|XP_020258050.1| sulfite reductase [ferredoxin], chloroplastic-like [Asparagus officinalis] gb|ONK76347.1| uncharacterized protein A4U43_C03F26640 [Asparagus officinalis] Length = 638 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 310 KDPNVQIHGYGFQGLRSARSIPIGRSVRASPTP 408 KDP VQI GYGF+GLRSA SIPIGRS R SP P Sbjct: 16 KDPKVQILGYGFRGLRSAGSIPIGRSARVSPVP 48