BLASTX nr result
ID: Ophiopogon22_contig00028358
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00028358 (505 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010915012.1| PREDICTED: subtilisin-like protease SBT1.7 [... 44 7e-06 >ref|XP_010915012.1| PREDICTED: subtilisin-like protease SBT1.7 [Elaeis guineensis] Length = 754 Score = 43.5 bits (101), Expect(2) = 7e-06 Identities = 18/30 (60%), Positives = 25/30 (83%) Frame = +1 Query: 4 EVPKGSIFLGNEELQARHMAFLPNATLGSG 93 E P+GS+FLG+E+L++ H +FLPN TL SG Sbjct: 46 EKPEGSVFLGDEDLESWHKSFLPNTTLDSG 75 Score = 33.9 bits (76), Expect(2) = 7e-06 Identities = 17/31 (54%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +3 Query: 93 QPRLMYSYHEVISSFAAK-TIEDVRDMEDME 182 +PRL+YSY IS FAA+ T E+VR +E M+ Sbjct: 76 EPRLVYSYRHAISGFAARLTPEEVRAIEAMD 106