BLASTX nr result
ID: Ophiopogon22_contig00028270
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00028270 (706 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK67124.1| uncharacterized protein A4U43_C06F15960 [Asparagu... 81 7e-16 >gb|ONK67124.1| uncharacterized protein A4U43_C06F15960 [Asparagus officinalis] Length = 118 Score = 80.9 bits (198), Expect = 7e-16 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = -3 Query: 206 GEGGQNCWCECVRTCNLKKHTTPENCEKQCDEACEEARYGGKPAGGGLYCEWR 48 GEGGQNCWC CVR C K+ C K+C EACE+A YGG P GG +C+WR Sbjct: 58 GEGGQNCWCTCVRQCMAKRQVPEAKCSKKCSEACEKADYGGMPIGGLKFCKWR 110