BLASTX nr result
ID: Ophiopogon22_contig00028114
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00028114 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK80962.1| uncharacterized protein A4U43_C01F23750 [Asparagu... 72 2e-11 ref|XP_020261539.1| LOW QUALITY PROTEIN: BTB/POZ domain and anky... 72 2e-11 ref|XP_009388569.1| PREDICTED: BTB/POZ domain and ankyrin repeat... 60 3e-07 gb|PKU82368.1| Regulatory protein NPR1 [Dendrobium catenatum] 55 1e-06 ref|XP_020702198.1| BTB/POZ domain and ankyrin repeat-containing... 55 8e-06 ref|XP_008782513.1| PREDICTED: regulatory protein NPR1 [Phoenix ... 55 9e-06 ref|XP_021650171.1| BTB/POZ domain and ankyrin repeat-containing... 55 9e-06 >gb|ONK80962.1| uncharacterized protein A4U43_C01F23750 [Asparagus officinalis] Length = 459 Score = 72.0 bits (175), Expect = 2e-11 Identities = 36/42 (85%), Positives = 40/42 (95%), Gaps = 2/42 (4%) Frame = -2 Query: 512 DDLTDIASFGND--SEERRKRYLELQGVLEKAFTADKQEFDR 393 D+LTDIASFG+D SEERR+RYLELQGVLEKAFTADK+EFDR Sbjct: 399 DELTDIASFGSDNSSEERRRRYLELQGVLEKAFTADKEEFDR 440 >ref|XP_020261539.1| LOW QUALITY PROTEIN: BTB/POZ domain and ankyrin repeat-containing protein NPR1-like [Asparagus officinalis] Length = 535 Score = 72.0 bits (175), Expect = 2e-11 Identities = 36/42 (85%), Positives = 40/42 (95%), Gaps = 2/42 (4%) Frame = -2 Query: 512 DDLTDIASFGND--SEERRKRYLELQGVLEKAFTADKQEFDR 393 D+LTDIASFG+D SEERR+RYLELQGVLEKAFTADK+EFDR Sbjct: 475 DELTDIASFGSDNSSEERRRRYLELQGVLEKAFTADKEEFDR 516 >ref|XP_009388569.1| PREDICTED: BTB/POZ domain and ankyrin repeat-containing protein NPR1 [Musa acuminata subsp. malaccensis] ref|XP_018678134.1| PREDICTED: BTB/POZ domain and ankyrin repeat-containing protein NPR1 [Musa acuminata subsp. malaccensis] Length = 584 Score = 59.7 bits (143), Expect = 3e-07 Identities = 33/60 (55%), Positives = 40/60 (66%), Gaps = 3/60 (5%) Frame = -2 Query: 512 DDLTDIASFG-NDSEERRKRYLELQGVLEKAFTADKQEFDR--XXXXXXXXXSGVARTRR 342 DD+T+I FG N SEE+R+R+LELQ VL KAF+ DK+EFDR GV RTRR Sbjct: 525 DDITEITGFGHNSSEEKRRRFLELQDVLSKAFSEDKEEFDRSSLSSSSSSTSVGVIRTRR 584 >gb|PKU82368.1| Regulatory protein NPR1 [Dendrobium catenatum] Length = 134 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/41 (65%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -2 Query: 512 DDLTDIASFGNDSEER-RKRYLELQGVLEKAFTADKQEFDR 393 DD+TD+ S GN+S E RKRY+ELQ +L KAFT DK+EFDR Sbjct: 74 DDVTDLTSSGNNSTEYGRKRYMELQDILTKAFTEDKEEFDR 114 >ref|XP_020702198.1| BTB/POZ domain and ankyrin repeat-containing protein NPR1-like [Dendrobium catenatum] Length = 444 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/41 (65%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -2 Query: 512 DDLTDIASFGNDSEER-RKRYLELQGVLEKAFTADKQEFDR 393 DD+TD+ S GN+S E RKRY+ELQ +L KAFT DK+EFDR Sbjct: 384 DDVTDLTSSGNNSTEYGRKRYMELQDILTKAFTEDKEEFDR 424 >ref|XP_008782513.1| PREDICTED: regulatory protein NPR1 [Phoenix dactylifera] Length = 570 Score = 55.5 bits (132), Expect = 9e-06 Identities = 27/41 (65%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -2 Query: 512 DDLTDIASFGND-SEERRKRYLELQGVLEKAFTADKQEFDR 393 DD +++ S G D SEE+RKRYLELQ VL KAF+ DK+EFDR Sbjct: 516 DDYSELTSLGQDASEEKRKRYLELQDVLTKAFSEDKEEFDR 556 >ref|XP_021650171.1| BTB/POZ domain and ankyrin repeat-containing protein NPR1-like [Hevea brasiliensis] Length = 584 Score = 55.5 bits (132), Expect = 9e-06 Identities = 28/44 (63%), Positives = 34/44 (77%), Gaps = 4/44 (9%) Frame = -2 Query: 512 DDLTDIASFGNDSEE----RRKRYLELQGVLEKAFTADKQEFDR 393 DDL+ +A+ GND+ E +RKRY+ELQ VL KAFT DKQEFDR Sbjct: 514 DDLSQLANLGNDTPEERLQKRKRYMELQVVLGKAFTEDKQEFDR 557