BLASTX nr result
ID: Ophiopogon22_contig00026469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00026469 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK78412.1| uncharacterized protein A4U43_C02F18500 [Asparagu... 55 8e-06 >gb|ONK78412.1| uncharacterized protein A4U43_C02F18500 [Asparagus officinalis] Length = 261 Score = 55.1 bits (131), Expect = 8e-06 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = +2 Query: 29 SDLNQPFMNMRQFSETDQSTVSAASENSLKRQRTAEEGGNYFSPAPKK 172 ++LN PF+NM FSET+ S+VS +ENSLKR+R EEG NY+ PA KK Sbjct: 181 TNLNHPFINMHPFSETESSSVS-ITENSLKRRRIGEEGPNYY-PASKK 226