BLASTX nr result
ID: Ophiopogon22_contig00026104
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00026104 (488 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK60095.1| uncharacterized protein A4U43_C08F14130 [Asparagu... 70 2e-12 ref|XP_008792748.1| PREDICTED: LOW QUALITY PROTEIN: chaperone pr... 70 9e-11 ref|XP_010936352.2| PREDICTED: chaperone protein ClpB3, chloropl... 69 2e-10 ref|XP_010936351.2| PREDICTED: chaperone protein ClpB3, chloropl... 69 2e-10 gb|PKA50318.1| Chaperone protein ClpB3, chloroplastic [Apostasia... 66 2e-09 gb|OAY80594.1| Chaperone protein ClpB3, chloroplastic [Ananas co... 66 2e-09 ref|XP_009404761.1| PREDICTED: chaperone protein ClpB3, chloropl... 65 5e-09 gb|PIA39486.1| hypothetical protein AQUCO_02600142v1 [Aquilegia ... 64 6e-09 gb|PIA39487.1| hypothetical protein AQUCO_02600142v1 [Aquilegia ... 64 7e-09 gb|OAY71448.1| Chaperone protein ClpB3, chloroplastic [Ananas co... 62 3e-08 ref|XP_010258150.1| PREDICTED: chaperone protein ClpB3, chloropl... 62 4e-08 ref|XP_020100059.1| chaperone protein ClpB3, chloroplastic [Anan... 62 6e-08 ref|XP_006287005.1| chaperone protein ClpB3, chloroplastic [Caps... 61 8e-08 gb|OVA00753.1| ClpA/B family [Macleaya cordata] 61 8e-08 gb|AAN17424.1| HSP100/ClpB, putative [Arabidopsis thaliana] >gi|... 59 1e-07 ref|XP_018816799.1| PREDICTED: chaperone protein ClpB3, chloropl... 60 1e-07 ref|XP_010420201.1| PREDICTED: chaperone protein ClpB3, chloropl... 60 3e-07 emb|CAN69514.1| hypothetical protein VITISV_009951 [Vitis vinifera] 59 3e-07 emb|CBI22284.3| unnamed protein product, partial [Vitis vinifera] 59 4e-07 gb|EXB38073.1| Chaperone protein [Morus notabilis] 59 4e-07 >gb|ONK60095.1| uncharacterized protein A4U43_C08F14130 [Asparagus officinalis] Length = 121 Score = 70.1 bits (170), Expect = 2e-12 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFSPS 355 ILVDTE+TAF NGQLPQ KLVFRK NS+ASDRPAE DQKA SPS Sbjct: 78 ILVDTELTAFLNGQLPQQKLVFRKGNSDASDRPAE-DQKALSPS 120 >ref|XP_008792748.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein ClpB3, chloroplastic [Phoenix dactylifera] Length = 984 Score = 69.7 bits (169), Expect = 9e-11 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFSPS 355 ILVDTE +AFSNGQLPQ KLVFR++N + SDRPA +DQ+AF PS Sbjct: 940 ILVDTEFSAFSNGQLPQQKLVFRRVNPDTSDRPASEDQRAFLPS 983 >ref|XP_010936352.2| PREDICTED: chaperone protein ClpB3, chloroplastic isoform X2 [Elaeis guineensis] Length = 992 Score = 68.6 bits (166), Expect = 2e-10 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFSPS 355 ILVDTEV+ FSNGQLPQ KLVFR+++ ++SD+PA +DQKAF PS Sbjct: 940 ILVDTEVSVFSNGQLPQQKLVFRRVDPDSSDKPASEDQKAFLPS 983 >ref|XP_010936351.2| PREDICTED: chaperone protein ClpB3, chloroplastic isoform X1 [Elaeis guineensis] Length = 995 Score = 68.6 bits (166), Expect = 2e-10 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFSPS 355 ILVDTEV+ FSNGQLPQ KLVFR+++ ++SD+PA +DQKAF PS Sbjct: 943 ILVDTEVSVFSNGQLPQQKLVFRRVDPDSSDKPASEDQKAFLPS 986 >gb|PKA50318.1| Chaperone protein ClpB3, chloroplastic [Apostasia shenzhenica] Length = 983 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFSPS 355 I +DTEVTAFSNGQLPQ KLVFR+ S +S+ P+ +DQKAFSPS Sbjct: 939 IEIDTEVTAFSNGQLPQQKLVFRQPESSSSEEPSAEDQKAFSPS 982 >gb|OAY80594.1| Chaperone protein ClpB3, chloroplastic [Ananas comosus] Length = 1036 Score = 65.9 bits (159), Expect = 2e-09 Identities = 34/45 (75%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASD-RPAEQDQKAFSPS 355 I VDTEVTAFSNGQLPQ KLVFRKLN E+S RPA + +KAF PS Sbjct: 991 ISVDTEVTAFSNGQLPQQKLVFRKLNPESSSGRPASEGEKAFQPS 1035 >ref|XP_009404761.1| PREDICTED: chaperone protein ClpB3, chloroplastic [Musa acuminata subsp. malaccensis] Length = 985 Score = 64.7 bits (156), Expect = 5e-09 Identities = 31/45 (68%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRK-LNSEASDRPAEQDQKAFSPS 355 +LVDTEVT FSNGQ PQ KLVFRK L++++SD+P+ +DQKAF PS Sbjct: 940 VLVDTEVTVFSNGQRPQQKLVFRKLLDADSSDKPSSEDQKAFLPS 984 >gb|PIA39486.1| hypothetical protein AQUCO_02600142v1 [Aquilegia coerulea] Length = 725 Score = 64.3 bits (155), Expect = 6e-09 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFSPS 355 IL+DTEV+AF+NGQLPQ KLVF+K+NS+ S+ PAE+D+KAFS S Sbjct: 681 ILIDTEVSAFANGQLPQQKLVFKKVNSD-SEAPAEKDEKAFSES 723 >gb|PIA39487.1| hypothetical protein AQUCO_02600142v1 [Aquilegia coerulea] Length = 984 Score = 64.3 bits (155), Expect = 7e-09 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFSPS 355 IL+DTEV+AF+NGQLPQ KLVF+K+NS+ S+ PAE+D+KAFS S Sbjct: 940 ILIDTEVSAFANGQLPQQKLVFKKVNSD-SEAPAEKDEKAFSES 982 >gb|OAY71448.1| Chaperone protein ClpB3, chloroplastic [Ananas comosus] Length = 293 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/45 (71%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASD-RPAEQDQKAFSPS 355 I VDTEV AFSNGQLPQ KLVFRKLN E+S PA + +KAF PS Sbjct: 248 ISVDTEVMAFSNGQLPQQKLVFRKLNPESSSGHPASEGEKAFQPS 292 >ref|XP_010258150.1| PREDICTED: chaperone protein ClpB3, chloroplastic [Nelumbo nucifera] Length = 978 Score = 62.0 bits (149), Expect = 4e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFS 361 IL+DTEVTAFSNGQLPQ KLVFRKL+S+ D P +D+KAFS Sbjct: 935 ILIDTEVTAFSNGQLPQQKLVFRKLSSDL-DMPEAEDEKAFS 975 >ref|XP_020100059.1| chaperone protein ClpB3, chloroplastic [Ananas comosus] Length = 988 Score = 61.6 bits (148), Expect = 6e-08 Identities = 32/45 (71%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASD-RPAEQDQKAFSPS 355 I VDTEV AFSNGQLPQ KLVFRKLN E+S PA + +KAF PS Sbjct: 943 ISVDTEVMAFSNGQLPQQKLVFRKLNPESSSGHPASEGEKAFQPS 987 >ref|XP_006287005.1| chaperone protein ClpB3, chloroplastic [Capsella rubella] gb|EOA19903.1| hypothetical protein CARUB_v10000151mg [Capsella rubella] Length = 971 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFS 361 IL+DTEVTAFSNGQLPQHKL+F+K+ SE + AEQ+++AFS Sbjct: 928 ILIDTEVTAFSNGQLPQHKLIFKKIESETAG--AEQEEEAFS 967 >gb|OVA00753.1| ClpA/B family [Macleaya cordata] Length = 982 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFS 361 IL+DTEV+AFSNGQLPQ KL+FRK++S+ SD P+ +DQK+FS Sbjct: 939 ILIDTEVSAFSNGQLPQQKLIFRKIDSD-SDIPSAEDQKSFS 979 >gb|AAN17424.1| HSP100/ClpB, putative [Arabidopsis thaliana] gb|AAO00929.1| HSP100/ClpB, putative [Arabidopsis thaliana] Length = 173 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFS 361 IL+DTEVTAFSNGQLPQ KL F+K+ SE +D AEQ++ AFS Sbjct: 133 ILIDTEVTAFSNGQLPQQKLTFKKIESETAD--AEQEEAAFS 172 >ref|XP_018816799.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Juglans regia] Length = 934 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFSPS 355 +L+DTEVTAFSNGQLPQ KLVFR L + S+ PA +D++AFSP+ Sbjct: 891 VLIDTEVTAFSNGQLPQQKLVFRTLGT-GSETPAAEDKEAFSPT 933 >ref|XP_010420201.1| PREDICTED: chaperone protein ClpB3, chloroplastic isoform X1 [Camelina sativa] ref|XP_010420202.1| PREDICTED: chaperone protein ClpB3, chloroplastic isoform X1 [Camelina sativa] ref|XP_019083823.1| PREDICTED: chaperone protein ClpB3, chloroplastic isoform X2 [Camelina sativa] Length = 971 Score = 59.7 bits (143), Expect = 3e-07 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFS 361 IL+DTEVTAFSNGQLPQ KL+F+K+ SEA+ AEQ+++AFS Sbjct: 929 ILIDTEVTAFSNGQLPQQKLIFKKIESEAAG--AEQEEEAFS 968 >emb|CAN69514.1| hypothetical protein VITISV_009951 [Vitis vinifera] Length = 790 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFS 361 +L+DTEVTAFSNGQLPQ KL+ RKL S+ SD PA + Q+AFS Sbjct: 747 VLIDTEVTAFSNGQLPQQKLILRKLESD-SDTPAAEGQEAFS 787 >emb|CBI22284.3| unnamed protein product, partial [Vitis vinifera] Length = 875 Score = 59.3 bits (142), Expect = 4e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFS 361 +L+DTEVTAFSNGQLPQ KL+ RKL S+ SD PA + Q+AFS Sbjct: 832 VLIDTEVTAFSNGQLPQQKLILRKLESD-SDTPAAEGQEAFS 872 >gb|EXB38073.1| Chaperone protein [Morus notabilis] Length = 959 Score = 59.3 bits (142), Expect = 4e-07 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -3 Query: 486 ILVDTEVTAFSNGQLPQHKLVFRKLNSEASDRPAEQDQKAFS 361 +L+DTEVTAFSNGQLPQ KLVFRKL S S+ A +DQ+AFS Sbjct: 916 VLIDTEVTAFSNGQLPQQKLVFRKLES-GSESQAAEDQEAFS 956