BLASTX nr result
ID: Ophiopogon22_contig00025893
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00025893 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273946.1| probable cyclic nucleotide-gated ion channel... 57 5e-07 gb|ONK65347.1| uncharacterized protein A4U43_C07F36180 [Asparagu... 57 5e-07 >ref|XP_020273946.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic [Asparagus officinalis] ref|XP_020273947.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic [Asparagus officinalis] Length = 757 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 372 ESPYWRNLATVRIQVAWKYRQKRLKKLRAPK 280 ESPYWRN+A VRIQVAWKYRQKRLK++ + K Sbjct: 715 ESPYWRNMAAVRIQVAWKYRQKRLKRIESHK 745 >gb|ONK65347.1| uncharacterized protein A4U43_C07F36180 [Asparagus officinalis] Length = 777 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 372 ESPYWRNLATVRIQVAWKYRQKRLKKLRAPK 280 ESPYWRN+A VRIQVAWKYRQKRLK++ + K Sbjct: 735 ESPYWRNMAAVRIQVAWKYRQKRLKRIESHK 765