BLASTX nr result
ID: Ophiopogon22_contig00025825
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00025825 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254582.1| triacylglycerol lipase SDP1 [Asparagus offic... 67 3e-10 ref|XP_021281755.1| triacylglycerol lipase SDP1-like [Herrania u... 64 2e-09 dbj|GAV73636.1| Patatin domain-containing protein/DUF3336 domain... 64 2e-09 ref|XP_011027299.1| PREDICTED: triacylglycerol lipase SDP1 [Popu... 63 5e-09 ref|XP_002308909.1| patatin-related family protein [Populus tric... 63 5e-09 ref|XP_011075385.1| triacylglycerol lipase SDP1 [Sesamum indicum] 63 6e-09 gb|OMO88044.1| Patatin/Phospholipase A2-related protein [Corchor... 63 6e-09 ref|XP_021908460.1| LOW QUALITY PROTEIN: triacylglycerol lipase ... 63 6e-09 ref|XP_017247247.1| PREDICTED: triacylglycerol lipase SDP1 [Dauc... 62 9e-09 ref|XP_018817209.1| PREDICTED: triacylglycerol lipase SDP1-like ... 62 9e-09 ref|XP_021666701.1| triacylglycerol lipase SDP1-like isoform X1 ... 62 9e-09 ref|XP_011033139.1| PREDICTED: triacylglycerol lipase SDP1-like ... 62 9e-09 ref|XP_002323263.1| patatin-related family protein [Populus tric... 62 9e-09 gb|OVA13752.1| Patatin/Phospholipase A2-related [Macleaya cordata] 62 1e-08 ref|XP_011078931.1| triacylglycerol lipase SDP1 [Sesamum indicum] 62 1e-08 emb|CBI30074.3| unnamed protein product, partial [Vitis vinifera] 62 2e-08 gb|EEF32280.1| conserved hypothetical protein, partial [Ricinus ... 62 2e-08 ref|XP_023918691.1| triacylglycerol lipase SDP1 [Quercus suber] ... 62 2e-08 gb|PON67418.1| Triacylglycerol lipase [Trema orientalis] 62 2e-08 gb|PON36406.1| Triacylglycerol lipase [Parasponia andersonii] 62 2e-08 >ref|XP_020254582.1| triacylglycerol lipase SDP1 [Asparagus officinalis] gb|ONK78433.1| uncharacterized protein A4U43_C02F18710 [Asparagus officinalis] Length = 830 Score = 66.6 bits (161), Expect = 3e-10 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MD+S EASINSFSIGPSS++GRTIAFRVLFC+SI+H Sbjct: 1 MDVSGEASINSFSIGPSSVIGRTIAFRVLFCSSISH 36 >ref|XP_021281755.1| triacylglycerol lipase SDP1-like [Herrania umbratica] ref|XP_021281756.1| triacylglycerol lipase SDP1-like [Herrania umbratica] Length = 849 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/36 (77%), Positives = 35/36 (97%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEAS++SFSIGPS+I+GRTIAFR+LFC S++H Sbjct: 1 MDISNEASVDSFSIGPSTIIGRTIAFRILFCKSLSH 36 >dbj|GAV73636.1| Patatin domain-containing protein/DUF3336 domain-containing protein [Cephalotus follicularis] Length = 845 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEAS+ SFSIGPS+I+GRTIAFR+LFC S++H Sbjct: 1 MDISNEASVESFSIGPSTIVGRTIAFRILFCKSVSH 36 >ref|XP_011027299.1| PREDICTED: triacylglycerol lipase SDP1 [Populus euphratica] Length = 856 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEAS++ F IGPSSI+GRTIAFRVLFC SI+H Sbjct: 1 MDISNEASVDPFKIGPSSIIGRTIAFRVLFCKSISH 36 >ref|XP_002308909.1| patatin-related family protein [Populus trichocarpa] gb|PNT29684.1| hypothetical protein POPTR_006G043800v3 [Populus trichocarpa] Length = 856 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEAS++ F IGPSSI+GRTIAFRVLFC SI+H Sbjct: 1 MDISNEASVDPFKIGPSSIIGRTIAFRVLFCKSISH 36 >ref|XP_011075385.1| triacylglycerol lipase SDP1 [Sesamum indicum] Length = 848 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEAS++SFSIGPS++ GRTIAFRVLFC S++H Sbjct: 1 MDISNEASVDSFSIGPSTLFGRTIAFRVLFCKSMSH 36 >gb|OMO88044.1| Patatin/Phospholipase A2-related protein [Corchorus capsularis] Length = 853 Score = 62.8 bits (151), Expect = 6e-09 Identities = 27/36 (75%), Positives = 35/36 (97%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEAS+++FSIGPS+I+GRTIAFR+LFC S++H Sbjct: 1 MDISNEASVDAFSIGPSTIIGRTIAFRILFCKSMSH 36 >ref|XP_021908460.1| LOW QUALITY PROTEIN: triacylglycerol lipase SDP1-like [Carica papaya] Length = 854 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEAS++ FSIGP+SI+GRTIAFR+LFC SI+H Sbjct: 1 MDISNEASVDPFSIGPTSIVGRTIAFRILFCKSISH 36 >ref|XP_017247247.1| PREDICTED: triacylglycerol lipase SDP1 [Daucus carota subsp. sativus] ref|XP_017247248.1| PREDICTED: triacylglycerol lipase SDP1 [Daucus carota subsp. sativus] Length = 820 Score = 62.4 bits (150), Expect = 9e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEA+++SF IGPS+ILGRTIAFRVLFC S++H Sbjct: 1 MDISNEANVDSFKIGPSTILGRTIAFRVLFCKSMSH 36 >ref|XP_018817209.1| PREDICTED: triacylglycerol lipase SDP1-like [Juglans regia] Length = 849 Score = 62.4 bits (150), Expect = 9e-09 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEAS++ FSIGPS+I+GRT+AFR+LFC SI+H Sbjct: 1 MDISNEASVDPFSIGPSTIVGRTVAFRILFCKSISH 36 >ref|XP_021666701.1| triacylglycerol lipase SDP1-like isoform X1 [Hevea brasiliensis] ref|XP_021666705.1| triacylglycerol lipase SDP1-like isoform X2 [Hevea brasiliensis] ref|XP_021666710.1| triacylglycerol lipase SDP1-like isoform X1 [Hevea brasiliensis] Length = 852 Score = 62.4 bits (150), Expect = 9e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEAS++ FSIGPS+I+GRTIAFRVLFC S++H Sbjct: 1 MDISNEASVDPFSIGPSTIIGRTIAFRVLFCKSMSH 36 >ref|XP_011033139.1| PREDICTED: triacylglycerol lipase SDP1-like [Populus euphratica] ref|XP_011033140.1| PREDICTED: triacylglycerol lipase SDP1-like [Populus euphratica] ref|XP_011033142.1| PREDICTED: triacylglycerol lipase SDP1-like [Populus euphratica] ref|XP_011033143.1| PREDICTED: triacylglycerol lipase SDP1-like [Populus euphratica] Length = 857 Score = 62.4 bits (150), Expect = 9e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEA+++ F IGPSSI+GRTIAFRVLFC SI+H Sbjct: 1 MDISNEANVDHFKIGPSSIIGRTIAFRVLFCNSISH 36 >ref|XP_002323263.1| patatin-related family protein [Populus trichocarpa] gb|PNS97774.1| hypothetical protein POPTR_016G041000v3 [Populus trichocarpa] gb|PNS97775.1| hypothetical protein POPTR_016G041000v3 [Populus trichocarpa] Length = 857 Score = 62.4 bits (150), Expect = 9e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEA+++ F IGPSSI+GRTIAFRVLFC SI+H Sbjct: 1 MDISNEANVDHFKIGPSSIIGRTIAFRVLFCNSISH 36 >gb|OVA13752.1| Patatin/Phospholipase A2-related [Macleaya cordata] Length = 834 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSIT 5 MDISNEAS++ FSIGPS+ILGRTIAFRVLFC+SI+ Sbjct: 1 MDISNEASVDPFSIGPSTILGRTIAFRVLFCSSIS 35 >ref|XP_011078931.1| triacylglycerol lipase SDP1 [Sesamum indicum] Length = 836 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEAS++ FSIGPS++ GRTIAFRVLFC SI+H Sbjct: 1 MDISNEASVDPFSIGPSTLFGRTIAFRVLFCKSISH 36 >emb|CBI30074.3| unnamed protein product, partial [Vitis vinifera] Length = 705 Score = 61.6 bits (148), Expect = 2e-08 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEAS++ FSIGPS+I+GRTIAFR+LFC S++H Sbjct: 1 MDISNEASVDPFSIGPSTIVGRTIAFRILFCKSMSH 36 >gb|EEF32280.1| conserved hypothetical protein, partial [Ricinus communis] Length = 797 Score = 61.6 bits (148), Expect = 2e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEAS++ FSIGPS+I+GRTIAFRVLFC S H Sbjct: 1 MDISNEASVDPFSIGPSTIIGRTIAFRVLFCKSFAH 36 >ref|XP_023918691.1| triacylglycerol lipase SDP1 [Quercus suber] gb|POF02630.1| triacylglycerol lipase sdp1 [Quercus suber] Length = 843 Score = 61.6 bits (148), Expect = 2e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISN+AS++ F IGPSSI+GRTIAFRVLFC S++H Sbjct: 1 MDISNDASVDPFKIGPSSIIGRTIAFRVLFCKSVSH 36 >gb|PON67418.1| Triacylglycerol lipase [Trema orientalis] Length = 845 Score = 61.6 bits (148), Expect = 2e-08 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEA+++SF IGPS+++GRTIAFRVLFC S+TH Sbjct: 1 MDISNEANVDSFRIGPSTLVGRTIAFRVLFCKSMTH 36 >gb|PON36406.1| Triacylglycerol lipase [Parasponia andersonii] Length = 845 Score = 61.6 bits (148), Expect = 2e-08 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 109 MDISNEASINSFSIGPSSILGRTIAFRVLFCTSITH 2 MDISNEA+++SF IGPS+++GRTIAFRVLFC S+TH Sbjct: 1 MDISNEANVDSFRIGPSTLVGRTIAFRVLFCKSMTH 36