BLASTX nr result
ID: Ophiopogon22_contig00025705
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00025705 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021902455.1| F-box protein SKIP23-like [Carica papaya] 56 2e-06 >ref|XP_021902455.1| F-box protein SKIP23-like [Carica papaya] Length = 395 Score = 56.2 bits (134), Expect = 2e-06 Identities = 38/119 (31%), Positives = 58/119 (48%), Gaps = 5/119 (4%) Frame = -3 Query: 393 REMEDYLVRRVILSADPGLTSDYAALAACAGDHTVLY-RAGDCAWTTLPGGFT---GAAF 226 R+M DY +++V+LS+ PG+ + + ALA + Y R GD W + G + F Sbjct: 158 RQMRDYFIKKVVLSSSPGMDTGFFALAILNQTGDLAYCRNGDNCWRLIEGLLSYCEDVIF 217 Query: 225 YRGRFY-VSVYGDVYVCEFGRGRNGRVEKKKVLSANWDWDVDESHLVVSGGDLLLVFVY 52 ++G FY V YG + VC+ G K ++ D +LV G +LLLV Y Sbjct: 218 FKGSFYAVDKYGTIMVCDL----RGYTPKISIVETPRQLGGDMQYLVGLGDELLLVTRY 272