BLASTX nr result
ID: Ophiopogon22_contig00025338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00025338 (581 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PRQ23654.1| putative laccase [Rosa chinensis] 52 6e-06 gb|PRQ23705.1| putative laccase [Rosa chinensis] 55 9e-06 >gb|PRQ23654.1| putative laccase [Rosa chinensis] Length = 58 Score = 52.0 bits (123), Expect = 6e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 503 QVVVKNVSRLCHAKPIVTVNGMYPGP 580 Q+ VKNVSRLCH KPIVTVNGM+PGP Sbjct: 7 QIQVKNVSRLCHPKPIVTVNGMFPGP 32 >gb|PRQ23705.1| putative laccase [Rosa chinensis] Length = 193 Score = 54.7 bits (130), Expect = 9e-06 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Frame = +2 Query: 440 LRLLRC---ILFCSCRGCLLVLTDQVVVKNVSRLCHAKPIVTVNGMYPGP 580 LRL C F + L + VKNVSRLCH+KPIVTVNGM+PGP Sbjct: 12 LRLFSCSVAFFFIPAKAALKTYQFDIQVKNVSRLCHSKPIVTVNGMFPGP 61