BLASTX nr result
ID: Ophiopogon22_contig00025048
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00025048 (537 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK55179.1| uncharacterized protein A4U43_UnF6710 [Asparagus ... 64 7e-09 ref|XP_020250681.1| cysteine-rich repeat secretory protein 38-li... 63 3e-08 gb|ONK64733.1| uncharacterized protein A4U43_C07F29310 [Asparagu... 60 3e-07 ref|XP_020250321.1| cysteine-rich repeat secretory protein 38-li... 57 3e-06 >gb|ONK55179.1| uncharacterized protein A4U43_UnF6710 [Asparagus officinalis] Length = 286 Score = 63.9 bits (154), Expect = 7e-09 Identities = 31/58 (53%), Positives = 43/58 (74%) Frame = +2 Query: 329 NKNTLTTSITRRRCSASSFPSRSIATMESNLDTFLLNLMTSEAQTTGFYNSSTGESPD 502 N N T IT+ CS S+FPS S+A +ESNL+ LL ++T+ AQT+GFYN++ GE+PD Sbjct: 172 NLNGTPTEITQYSCSDSTFPSNSLAIVESNLNN-LLQILTTNAQTSGFYNTTVGENPD 228 >ref|XP_020250681.1| cysteine-rich repeat secretory protein 38-like [Asparagus officinalis] gb|ONK54907.1| uncharacterized protein A4U43_UnF9850 [Asparagus officinalis] Length = 374 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/58 (55%), Positives = 41/58 (70%) Frame = +2 Query: 329 NKNTLTTSITRRRCSASSFPSRSIATMESNLDTFLLNLMTSEAQTTGFYNSSTGESPD 502 N N T IT CS S FPS S+A +ESNL+ L NL T++AQT+GFYN++ GE+PD Sbjct: 249 NLNGTPTVITEHSCSDSIFPSNSLAIVESNLNNLLQNL-TTKAQTSGFYNTTVGENPD 305 >gb|ONK64733.1| uncharacterized protein A4U43_C07F29310 [Asparagus officinalis] Length = 753 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = +2 Query: 329 NKNTLTTSITRRRCSASSFPSRSIATMESNLDTFLLNLMTSEAQTTGFYNSSTGESPD 502 N N T IT+ CS S+FPS S+A +ESNL+ LL ++T+ AQT+GFYN++ GE+ D Sbjct: 164 NLNGTPTVITQYSCSDSTFPSNSLAIVESNLNN-LLQILTTNAQTSGFYNTTVGENKD 220 >ref|XP_020250321.1| cysteine-rich repeat secretory protein 38-like [Asparagus officinalis] Length = 359 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/45 (57%), Positives = 37/45 (82%) Frame = +2 Query: 368 CSASSFPSRSIATMESNLDTFLLNLMTSEAQTTGFYNSSTGESPD 502 CS S+FPS S+A +ESNL+ LL ++T+ AQT+GFYN++ GE+PD Sbjct: 135 CSDSTFPSNSLAIVESNLNN-LLQILTTNAQTSGFYNTTVGENPD 178