BLASTX nr result
ID: Ophiopogon22_contig00024994
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00024994 (389 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019072785.1| PREDICTED: KH domain-containing protein At5g... 103 7e-25 gb|OMP06918.1| hypothetical protein COLO4_07780 [Corchorus olito... 106 1e-24 ref|XP_002274648.1| PREDICTED: KH domain-containing protein At5g... 103 2e-24 ref|XP_021745035.1| KH domain-containing protein At5g56140-like ... 102 6e-24 ref|XP_021740805.1| KH domain-containing protein At5g56140-like ... 102 6e-24 gb|KHN01498.1| KH domain-containing protein [Glycine soja] >gi|9... 101 6e-24 ref|XP_022716612.1| KH domain-containing protein At5g56140-like ... 102 6e-24 ref|XP_021745030.1| KH domain-containing protein At5g56140-like ... 102 6e-24 ref|XP_021740802.1| KH domain-containing protein At5g56140-like ... 102 6e-24 ref|XP_023891836.1| KH domain-containing protein At4g26480-like,... 98 7e-24 ref|XP_022733746.1| KH domain-containing protein At5g56140-like ... 102 7e-24 gb|KYP59806.1| KH domain-containing protein At5g56140 family [Ca... 101 1e-23 gb|OIW12025.1| hypothetical protein TanjilG_27322 [Lupinus angus... 100 2e-23 ref|XP_020224025.1| KH domain-containing protein At5g56140-like ... 101 2e-23 ref|XP_003522828.1| PREDICTED: KH domain-containing protein At5g... 101 2e-23 ref|XP_021841889.1| KH domain-containing protein At5g56140 isofo... 101 2e-23 ref|XP_003527575.1| PREDICTED: KH domain-containing protein At5g... 101 2e-23 ref|XP_021841888.1| KH domain-containing protein At5g56140 isofo... 101 2e-23 gb|KNA18099.1| hypothetical protein SOVF_073820 [Spinacia oleracea] 101 2e-23 ref|XP_010252937.1| PREDICTED: KH domain-containing protein At5g... 101 2e-23 >ref|XP_019072785.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 [Vitis vinifera] Length = 235 Score = 103 bits (258), Expect = 7e-25 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDFFKKQQLRELAMLNGTLREEGS+MSGSVSPFHNSLGMKRAKTR Sbjct: 183 LKPVDESQDFFKKQQLRELAMLNGTLREEGSHMSGSVSPFHNSLGMKRAKTR 234 >gb|OMP06918.1| hypothetical protein COLO4_07780 [Corchorus olitorius] Length = 433 Score = 106 bits (265), Expect = 1e-24 Identities = 57/90 (63%), Positives = 60/90 (66%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTRXXXXXXXX 208 LKPVDESQDF+KKQQLRELAMLNGTLREEGS MSGSVSPFHNSLGMKRAKTR Sbjct: 300 LKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMKRAKTRGCCCFSQC 359 Query: 207 XXXXXXVSPRKPIP*MPAGHWHQEGS*LDC 118 +P+GHWH L C Sbjct: 360 LQ-------------LPSGHWHYYAPVLTC 376 >ref|XP_002274648.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 [Vitis vinifera] emb|CBI39805.3| unnamed protein product, partial [Vitis vinifera] Length = 287 Score = 103 bits (258), Expect = 2e-24 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDFFKKQQLRELAMLNGTLREEGS+MSGSVSPFHNSLGMKRAKTR Sbjct: 235 LKPVDESQDFFKKQQLRELAMLNGTLREEGSHMSGSVSPFHNSLGMKRAKTR 286 >ref|XP_021745035.1| KH domain-containing protein At5g56140-like isoform X2 [Chenopodium quinoa] Length = 290 Score = 102 bits (255), Expect = 6e-24 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDFFKKQQLRELAMLNGTLRE+GS+MSGSVSPFHNSLGMKRAKTR Sbjct: 238 LKPVDESQDFFKKQQLRELAMLNGTLREDGSHMSGSVSPFHNSLGMKRAKTR 289 >ref|XP_021740805.1| KH domain-containing protein At5g56140-like isoform X2 [Chenopodium quinoa] Length = 290 Score = 102 bits (255), Expect = 6e-24 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDFFKKQQLRELAMLNGTLRE+GS+MSGSVSPFHNSLGMKRAKTR Sbjct: 238 LKPVDESQDFFKKQQLRELAMLNGTLREDGSHMSGSVSPFHNSLGMKRAKTR 289 >gb|KHN01498.1| KH domain-containing protein [Glycine soja] gb|KRH62503.1| hypothetical protein GLYMA_04G111900 [Glycine max] Length = 238 Score = 101 bits (252), Expect = 6e-24 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDF+KKQQLRELAMLNGTLREEGS MSGSVSPFHNSLGMKRAKTR Sbjct: 186 LKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMKRAKTR 237 >ref|XP_022716612.1| KH domain-containing protein At5g56140-like [Durio zibethinus] Length = 291 Score = 102 bits (255), Expect = 6e-24 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDF+KKQQLRELAMLNGTLREEGS+MSGSVSPFHNSLGMKRAKTR Sbjct: 239 LKPVDESQDFYKKQQLRELAMLNGTLREEGSSMSGSVSPFHNSLGMKRAKTR 290 >ref|XP_021745030.1| KH domain-containing protein At5g56140-like isoform X1 [Chenopodium quinoa] ref|XP_021745031.1| KH domain-containing protein At5g56140-like isoform X1 [Chenopodium quinoa] ref|XP_021745033.1| KH domain-containing protein At5g56140-like isoform X1 [Chenopodium quinoa] ref|XP_021745034.1| KH domain-containing protein At5g56140-like isoform X1 [Chenopodium quinoa] Length = 291 Score = 102 bits (255), Expect = 6e-24 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDFFKKQQLRELAMLNGTLRE+GS+MSGSVSPFHNSLGMKRAKTR Sbjct: 239 LKPVDESQDFFKKQQLRELAMLNGTLREDGSHMSGSVSPFHNSLGMKRAKTR 290 >ref|XP_021740802.1| KH domain-containing protein At5g56140-like isoform X1 [Chenopodium quinoa] ref|XP_021740803.1| KH domain-containing protein At5g56140-like isoform X1 [Chenopodium quinoa] Length = 291 Score = 102 bits (255), Expect = 6e-24 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDFFKKQQLRELAMLNGTLRE+GS+MSGSVSPFHNSLGMKRAKTR Sbjct: 239 LKPVDESQDFFKKQQLRELAMLNGTLREDGSHMSGSVSPFHNSLGMKRAKTR 290 >ref|XP_023891836.1| KH domain-containing protein At4g26480-like, partial [Quercus suber] Length = 107 Score = 97.8 bits (242), Expect = 7e-24 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDE+ DF+KKQQLRELAM+NGTLREEGS MSGSVSPFHNSLGMKRAKTR Sbjct: 55 LKPVDETHDFYKKQQLRELAMINGTLREEGSPMSGSVSPFHNSLGMKRAKTR 106 >ref|XP_022733746.1| KH domain-containing protein At5g56140-like [Durio zibethinus] Length = 300 Score = 102 bits (255), Expect = 7e-24 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDF+KKQQLRELAMLNGTLREEGS+MSGSVSPFHNSLGMKRAKTR Sbjct: 248 LKPVDESQDFYKKQQLRELAMLNGTLREEGSHMSGSVSPFHNSLGMKRAKTR 299 >gb|KYP59806.1| KH domain-containing protein At5g56140 family [Cajanus cajan] Length = 281 Score = 101 bits (252), Expect = 1e-23 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDF+KKQQLRELAMLNGTLREEGS MSGSVSPFHNSLGMKRAKTR Sbjct: 229 LKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMKRAKTR 280 >gb|OIW12025.1| hypothetical protein TanjilG_27322 [Lupinus angustifolius] Length = 238 Score = 100 bits (249), Expect = 2e-23 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDF+KKQQLRELA+LNGTLREEGS MSGSVSPFHNSLGMKRAKTR Sbjct: 186 LKPVDESQDFYKKQQLRELALLNGTLREEGSPMSGSVSPFHNSLGMKRAKTR 237 >ref|XP_020224025.1| KH domain-containing protein At5g56140-like [Cajanus cajan] Length = 291 Score = 101 bits (252), Expect = 2e-23 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDF+KKQQLRELAMLNGTLREEGS MSGSVSPFHNSLGMKRAKTR Sbjct: 239 LKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMKRAKTR 290 >ref|XP_003522828.1| PREDICTED: KH domain-containing protein At5g56140-like [Glycine max] gb|KRH62502.1| hypothetical protein GLYMA_04G111900 [Glycine max] Length = 291 Score = 101 bits (252), Expect = 2e-23 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDF+KKQQLRELAMLNGTLREEGS MSGSVSPFHNSLGMKRAKTR Sbjct: 239 LKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMKRAKTR 290 >ref|XP_021841889.1| KH domain-containing protein At5g56140 isoform X2 [Spinacia oleracea] Length = 292 Score = 101 bits (252), Expect = 2e-23 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQD+FKKQQLRELAMLNGTLRE+GS+MSGSVSPFHNSLGMKRAKTR Sbjct: 240 LKPVDESQDYFKKQQLRELAMLNGTLREDGSHMSGSVSPFHNSLGMKRAKTR 291 >ref|XP_003527575.1| PREDICTED: KH domain-containing protein At5g56140-like [Glycine max] gb|KHN20564.1| KH domain-containing protein [Glycine soja] gb|KRH56406.1| hypothetical protein GLYMA_06G322300 [Glycine max] Length = 292 Score = 101 bits (252), Expect = 2e-23 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQDF+KKQQLRELAMLNGTLREEGS MSGSVSPFHNSLGMKRAKTR Sbjct: 240 LKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMKRAKTR 291 >ref|XP_021841888.1| KH domain-containing protein At5g56140 isoform X1 [Spinacia oleracea] Length = 293 Score = 101 bits (252), Expect = 2e-23 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQD+FKKQQLRELAMLNGTLRE+GS+MSGSVSPFHNSLGMKRAKTR Sbjct: 241 LKPVDESQDYFKKQQLRELAMLNGTLREDGSHMSGSVSPFHNSLGMKRAKTR 292 >gb|KNA18099.1| hypothetical protein SOVF_073820 [Spinacia oleracea] Length = 293 Score = 101 bits (252), Expect = 2e-23 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKPVDESQD+FKKQQLRELAMLNGTLRE+GS+MSGSVSPFHNSLGMKRAKTR Sbjct: 241 LKPVDESQDYFKKQQLRELAMLNGTLREDGSHMSGSVSPFHNSLGMKRAKTR 292 >ref|XP_010252937.1| PREDICTED: KH domain-containing protein At5g56140-like isoform X2 [Nelumbo nucifera] Length = 294 Score = 101 bits (252), Expect = 2e-23 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 387 LKPVDESQDFFKKQQLRELAMLNGTLREEGSNMSGSVSPFHNSLGMKRAKTR 232 LKP+DESQDFFKKQQLRELAMLNGTLREEGS++SGSVSPFHNSLGMKRAKTR Sbjct: 242 LKPMDESQDFFKKQQLRELAMLNGTLREEGSHLSGSVSPFHNSLGMKRAKTR 293