BLASTX nr result
ID: Ophiopogon22_contig00024946
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00024946 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260990.1| protein NLP1-like [Asparagus officinalis] >g... 69 3e-11 gb|ONK55926.1| uncharacterized protein A4U43_C10F2370 [Asparagus... 58 2e-07 ref|XP_020248824.1| protein NLP1-like [Asparagus officinalis] >g... 58 3e-07 >ref|XP_020260990.1| protein NLP1-like [Asparagus officinalis] gb|ONK71922.1| uncharacterized protein A4U43_C04F13790 [Asparagus officinalis] Length = 922 Score = 69.3 bits (168), Expect = 3e-11 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = -3 Query: 165 SAMEDDAVPQLPESSLERVLSDSEVDFDLMDEILSGDCWFETPNYCDLFQ 16 SAMED + E S ER LSDS VDFDLMDEILSGDCW +TP+Y DLFQ Sbjct: 5 SAMEDSGARKT-ECSPERSLSDSAVDFDLMDEILSGDCWLQTPDYSDLFQ 53 >gb|ONK55926.1| uncharacterized protein A4U43_C10F2370 [Asparagus officinalis] Length = 270 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 150 DAVPQLPESSLERVLSDSEVDFDLMDEILSGDCWFET 40 DA Q P SSLER +S S VDFDLMDE+LSGDCWF+T Sbjct: 3 DASAQRPGSSLERAVSCSSVDFDLMDEMLSGDCWFQT 39 >ref|XP_020248824.1| protein NLP1-like [Asparagus officinalis] ref|XP_020248827.1| protein NLP1-like [Asparagus officinalis] ref|XP_020248828.1| protein NLP1-like [Asparagus officinalis] Length = 777 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 150 DAVPQLPESSLERVLSDSEVDFDLMDEILSGDCWFET 40 DA Q P SSLER +S S VDFDLMDE+LSGDCWF+T Sbjct: 3 DASAQRPGSSLERAVSCSSVDFDLMDEMLSGDCWFQT 39