BLASTX nr result
ID: Ophiopogon22_contig00024932
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00024932 (579 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250466.1| conserved oligomeric Golgi complex subunit 8... 61 1e-07 >ref|XP_020250466.1| conserved oligomeric Golgi complex subunit 8 [Asparagus officinalis] gb|ONK55079.1| uncharacterized protein A4U43_UnF7830 [Asparagus officinalis] Length = 578 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -2 Query: 578 VRPTSENGGDMVVESKVASVDDSVLEDGVTDQSAKEVNRLESRSSV 441 V+ TSENGGDMVV V SVDDSVLE+ TDQ E +RLESRSS+ Sbjct: 533 VKHTSENGGDMVVVGNVTSVDDSVLENSGTDQKGTETSRLESRSSI 578