BLASTX nr result
ID: Ophiopogon22_contig00024791
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00024791 (563 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010922954.1| PREDICTED: uncharacterized protein LOC105046... 56 4e-06 >ref|XP_010922954.1| PREDICTED: uncharacterized protein LOC105046133 [Elaeis guineensis] Length = 255 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +3 Query: 3 YHRYHDYLEELWTVAKDHVVRIVLHDALQCVV*FHHLFNQS 125 YHR HD+LEELW A++ + R +LH LQC V FHHLFNQ+ Sbjct: 92 YHRCHDFLEELWNGAEEPI-RTLLHGILQCAVGFHHLFNQN 131