BLASTX nr result
ID: Ophiopogon22_contig00024790
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00024790 (628 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK76115.1| uncharacterized protein A4U43_C03F24060 [Asparagu... 58 3e-06 ref|XP_020257888.1| uncharacterized protein LOC109834309 [Aspara... 58 3e-06 >gb|ONK76115.1| uncharacterized protein A4U43_C03F24060 [Asparagus officinalis] Length = 382 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +2 Query: 239 HDSNKHFLSKTPRIWPELEFNWQTVLATIIGFLGSAF 349 +DS + LS++ R+WP+LEFNW TVL T+IGFLG AF Sbjct: 41 NDSRRRLLSRSVRVWPDLEFNWSTVLVTVIGFLGCAF 77 >ref|XP_020257888.1| uncharacterized protein LOC109834309 [Asparagus officinalis] Length = 462 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +2 Query: 239 HDSNKHFLSKTPRIWPELEFNWQTVLATIIGFLGSAF 349 +DS + LS++ R+WP+LEFNW TVL T+IGFLG AF Sbjct: 41 NDSRRRLLSRSVRVWPDLEFNWSTVLVTVIGFLGCAF 77