BLASTX nr result
ID: Ophiopogon22_contig00024703
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00024703 (389 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA54499.1| ataxia telangiectasia mutated family protein [Apo... 53 3e-06 gb|PKA60244.1| ataxia telangiectasia mutated family protein [Apo... 53 3e-06 gb|PKA51786.1| ataxia telangiectasia mutated family protein [Apo... 53 3e-06 gb|PKA51585.1| ataxia telangiectasia mutated family protein [Apo... 53 4e-06 >gb|PKA54499.1| ataxia telangiectasia mutated family protein [Apostasia shenzhenica] Length = 108 Score = 52.8 bits (125), Expect = 3e-06 Identities = 20/43 (46%), Positives = 30/43 (69%) Frame = +1 Query: 1 RTRGRPKRIWMKTIKKGIKVLNLSMEMILNRAKWKKKIHADDP 129 R RGRPK+ W +TI+ + LNL ++ +RA+WK++IH DP Sbjct: 65 RGRGRPKKTWQETIRSDLSYLNLDKNLVTDRAQWKQRIHVADP 107 >gb|PKA60244.1| ataxia telangiectasia mutated family protein [Apostasia shenzhenica] Length = 110 Score = 52.8 bits (125), Expect = 3e-06 Identities = 20/43 (46%), Positives = 30/43 (69%) Frame = +1 Query: 1 RTRGRPKRIWMKTIKKGIKVLNLSMEMILNRAKWKKKIHADDP 129 R RGRPK+ W +TI+ + LNL ++ +RA+WK++IH DP Sbjct: 67 RGRGRPKKTWQETIRSDLSYLNLDKNLVTDRAQWKQRIHVADP 109 >gb|PKA51786.1| ataxia telangiectasia mutated family protein [Apostasia shenzhenica] Length = 132 Score = 53.1 bits (126), Expect = 3e-06 Identities = 20/43 (46%), Positives = 30/43 (69%) Frame = +1 Query: 1 RTRGRPKRIWMKTIKKGIKVLNLSMEMILNRAKWKKKIHADDP 129 R RGRPK+ W +TI+ + LNL ++ +RA+WK++IH DP Sbjct: 89 RGRGRPKKTWQETIRSNLSYLNLDKNLVTDRAQWKQRIHVADP 131 >gb|PKA51585.1| ataxia telangiectasia mutated family protein [Apostasia shenzhenica] Length = 132 Score = 52.8 bits (125), Expect = 4e-06 Identities = 20/43 (46%), Positives = 30/43 (69%) Frame = +1 Query: 1 RTRGRPKRIWMKTIKKGIKVLNLSMEMILNRAKWKKKIHADDP 129 R RGRPK+ W +TI+ + LNL ++ +RA+WK++IH DP Sbjct: 89 RGRGRPKKTWQETIRNDLSYLNLDKNLVTDRAQWKQRIHVADP 131