BLASTX nr result
ID: Ophiopogon22_contig00024626
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00024626 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275266.1| pentatricopeptide repeat-containing protein ... 78 3e-14 ref|XP_008793356.1| PREDICTED: pentatricopeptide repeat-containi... 69 4e-11 ref|XP_010938199.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-10 ref|XP_010515205.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-07 ref|XP_010503521.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-07 ref|XP_010546953.1| PREDICTED: pentatricopeptide repeat-containi... 56 1e-06 ref|XP_010546952.1| PREDICTED: pentatricopeptide repeat-containi... 56 1e-06 ref|XP_010426378.1| PREDICTED: pentatricopeptide repeat-containi... 55 3e-06 gb|OAP03380.1| hypothetical protein AXX17_AT3G42960 [Arabidopsis... 55 3e-06 ref|NP_190450.1| Pentatricopeptide repeat (PPR) superfamily prot... 55 3e-06 >ref|XP_020275266.1| pentatricopeptide repeat-containing protein At3g48810 [Asparagus officinalis] ref|XP_020275267.1| pentatricopeptide repeat-containing protein At3g48810 [Asparagus officinalis] gb|ONK63176.1| uncharacterized protein A4U43_C07F12190 [Asparagus officinalis] Length = 684 Score = 77.8 bits (190), Expect = 3e-14 Identities = 43/59 (72%), Positives = 47/59 (79%), Gaps = 2/59 (3%) Frame = -1 Query: 173 MYLREGCQLLLKARKPPLQMTLNMNLISDHLQIQEH--SRPLSLREADVCERLRHEKCI 3 M L+EGCQLLLKARKPPLQMTLN+NLISD QIQE + PL LRE DV RL+HEK I Sbjct: 1 MCLKEGCQLLLKARKPPLQMTLNLNLISDRPQIQEQNCNSPL-LREGDVWNRLKHEKSI 58 >ref|XP_008793356.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 [Phoenix dactylifera] Length = 669 Score = 68.9 bits (167), Expect = 4e-11 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = -1 Query: 173 MYLREGCQLLLKARKPPLQMTLNMNLISDHLQIQEHSRPLSLREADVCERLRHEKCI 3 MYL+EGC LLLK RKP + M L +NLISDH Q+++ S P LRE DV R+RHE+ I Sbjct: 1 MYLKEGCSLLLKVRKPVVPMALTLNLISDHKQVKDMSAP-RLREIDVVNRIRHERDI 56 >ref|XP_010938199.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 [Elaeis guineensis] ref|XP_019710270.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 [Elaeis guineensis] Length = 670 Score = 67.4 bits (163), Expect = 1e-10 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = -1 Query: 173 MYLREGCQLLLKARKPPLQMTLNMNLISDHLQIQEHSRPLSLREADVCERLRHEKCI 3 MYL+EGC LLLK RKP M L MNLISDH ++++ S P LRE DV R+RHE+ I Sbjct: 1 MYLKEGCSLLLKVRKPVQPMALMMNLISDHKRVKDMSAP-KLRETDVVNRIRHERDI 56 >ref|XP_010515205.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 [Camelina sativa] Length = 654 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/57 (45%), Positives = 37/57 (64%) Frame = -1 Query: 173 MYLREGCQLLLKARKPPLQMTLNMNLISDHLQIQEHSRPLSLREADVCERLRHEKCI 3 MYL+EGC LLLK +KP + LN NL +HL + + ++E+DV +RLR E C+ Sbjct: 1 MYLKEGCSLLLKVQKPLIPFVLNTNLNVNHLLPEATTNHAEIKESDVVKRLRQESCV 57 >ref|XP_010503521.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810-like [Camelina sativa] Length = 654 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/57 (45%), Positives = 37/57 (64%) Frame = -1 Query: 173 MYLREGCQLLLKARKPPLQMTLNMNLISDHLQIQEHSRPLSLREADVCERLRHEKCI 3 MYL+EGC LLLK +KP + LN NL +HL + + ++E+DV +RLR E C+ Sbjct: 1 MYLKEGCSLLLKVQKPLIPFVLNTNLNVNHLLPEATTNHAEIKESDVVKRLRQESCV 57 >ref|XP_010546953.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 isoform X2 [Tarenaya hassleriana] Length = 628 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/57 (47%), Positives = 36/57 (63%) Frame = -1 Query: 173 MYLREGCQLLLKARKPPLQMTLNMNLISDHLQIQEHSRPLSLREADVCERLRHEKCI 3 MYLREGC LLLK +KP + LN NL + L ++ P ++E DV +RLR E C+ Sbjct: 1 MYLREGCSLLLKVQKPSIPFVLNTNLNGNFL--RDGPNPAEIKETDVVKRLRQESCV 55 >ref|XP_010546952.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 isoform X1 [Tarenaya hassleriana] Length = 689 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/57 (47%), Positives = 36/57 (63%) Frame = -1 Query: 173 MYLREGCQLLLKARKPPLQMTLNMNLISDHLQIQEHSRPLSLREADVCERLRHEKCI 3 MYLREGC LLLK +KP + LN NL + L ++ P ++E DV +RLR E C+ Sbjct: 1 MYLREGCSLLLKVQKPSIPFVLNTNLNGNFL--RDGPNPAEIKETDVVKRLRQESCV 55 >ref|XP_010426378.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810-like [Camelina sativa] Length = 654 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/57 (45%), Positives = 36/57 (63%) Frame = -1 Query: 173 MYLREGCQLLLKARKPPLQMTLNMNLISDHLQIQEHSRPLSLREADVCERLRHEKCI 3 MYL EGC LLLK +KP + LN NL +HL + + ++E+DV +RLR E C+ Sbjct: 1 MYLVEGCSLLLKVQKPLIPFVLNTNLNVNHLFPEATTNQAEIKESDVVKRLRQESCV 57 >gb|OAP03380.1| hypothetical protein AXX17_AT3G42960 [Arabidopsis thaliana] Length = 659 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/57 (47%), Positives = 36/57 (63%) Frame = -1 Query: 173 MYLREGCQLLLKARKPPLQMTLNMNLISDHLQIQEHSRPLSLREADVCERLRHEKCI 3 MYL+EGC LLLK +KP + LN NL +HL + E ++E DV +RLR E C+ Sbjct: 1 MYLKEGCSLLLKVQKPLIPFVLNTNLNVNHL-LTESPNHAEIKELDVVKRLRQESCV 56 >ref|NP_190450.1| Pentatricopeptide repeat (PPR) superfamily protein [Arabidopsis thaliana] sp|Q9M302.1|PP270_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g48810 emb|CAB87909.1| putative protein [Arabidopsis thaliana] gb|AEE78458.1| Pentatricopeptide repeat (PPR) superfamily protein [Arabidopsis thaliana] Length = 659 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/57 (47%), Positives = 36/57 (63%) Frame = -1 Query: 173 MYLREGCQLLLKARKPPLQMTLNMNLISDHLQIQEHSRPLSLREADVCERLRHEKCI 3 MYL+EGC LLLK +KP + LN NL +HL + E ++E DV +RLR E C+ Sbjct: 1 MYLKEGCSLLLKVQKPLIPFVLNTNLNVNHL-LTESPNHAEIKELDVVKRLRQESCV 56