BLASTX nr result
ID: Ophiopogon22_contig00024480
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00024480 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256404.1| probable E3 ubiquitin-protein ligase ARI2 is... 66 1e-09 ref|XP_020256402.1| probable E3 ubiquitin-protein ligase ARI1 is... 66 1e-09 >ref|XP_020256404.1| probable E3 ubiquitin-protein ligase ARI2 isoform X2 [Asparagus officinalis] Length = 508 Score = 66.2 bits (160), Expect = 1e-09 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +2 Query: 2 DLLEPLGSTTHQIAPYKSNGVERAPELSIHSESSVEHKKHFNS 130 DLLEPLG+ THQIAPYKSNGVERAPELSI+ + E KH +S Sbjct: 466 DLLEPLGNATHQIAPYKSNGVERAPELSIYLDHCAEQGKHVSS 508 >ref|XP_020256402.1| probable E3 ubiquitin-protein ligase ARI1 isoform X1 [Asparagus officinalis] ref|XP_020256403.1| probable E3 ubiquitin-protein ligase ARI1 isoform X1 [Asparagus officinalis] gb|ONK74594.1| uncharacterized protein A4U43_C03F8100 [Asparagus officinalis] Length = 549 Score = 66.2 bits (160), Expect = 1e-09 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +2 Query: 2 DLLEPLGSTTHQIAPYKSNGVERAPELSIHSESSVEHKKHFNS 130 DLLEPLG+ THQIAPYKSNGVERAPELSI+ + E KH +S Sbjct: 507 DLLEPLGNATHQIAPYKSNGVERAPELSIYLDHCAEQGKHVSS 549