BLASTX nr result
ID: Ophiopogon22_contig00024007
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00024007 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK62405.1| uncharacterized protein A4U43_C07F3530 [Asparagus... 69 4e-12 gb|PKA62645.1| hypothetical protein AXF42_Ash012232 [Apostasia s... 57 4e-08 gb|PKU81226.1| hypothetical protein MA16_Dca026649 [Dendrobium c... 53 1e-06 gb|PKU81227.1| hypothetical protein MA16_Dca026650 [Dendrobium c... 52 2e-06 gb|PKU81228.1| hypothetical protein MA16_Dca026651 [Dendrobium c... 52 3e-06 >gb|ONK62405.1| uncharacterized protein A4U43_C07F3530 [Asparagus officinalis] Length = 150 Score = 68.9 bits (167), Expect = 4e-12 Identities = 37/63 (58%), Positives = 46/63 (73%), Gaps = 5/63 (7%) Frame = -1 Query: 369 AMEHQVSFTQKKGKPLPKRGQIKAQIIGTLVRSLVPKSS*ERGKTE-----LGLFYAAYE 205 AMEH+VSF++K+G PLPKRG+IKAQI G+LVRSLVPKSS + K E L +E Sbjct: 85 AMEHKVSFSRKRGMPLPKRGRIKAQIFGSLVRSLVPKSSNKGRKYEEEEGGLDSMTPVFE 144 Query: 204 WLQ 196 WL+ Sbjct: 145 WLR 147 >gb|PKA62645.1| hypothetical protein AXF42_Ash012232 [Apostasia shenzhenica] Length = 71 Score = 56.6 bits (135), Expect = 4e-08 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -1 Query: 366 MEHQVSFTQKKGKPLPKRGQIKAQIIGTLVRSLVPKSS 253 MEHQ Q+KG PLP+RGQ+KA+IIG LVRS++P SS Sbjct: 1 MEHQTLAAQRKGNPLPRRGQVKARIIGGLVRSIIPSSS 38 >gb|PKU81226.1| hypothetical protein MA16_Dca026649 [Dendrobium catenatum] Length = 70 Score = 52.8 bits (125), Expect = 1e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = -1 Query: 366 MEHQVSFTQKKGKPLPKRGQIKAQIIGTLVRSLVPKSS 253 ME+Q +KKG PLP+RGQ+KA+I G+LVRS++P SS Sbjct: 1 MEYQKQRFEKKGNPLPRRGQVKARIFGSLVRSIIPSSS 38 >gb|PKU81227.1| hypothetical protein MA16_Dca026650 [Dendrobium catenatum] Length = 70 Score = 52.4 bits (124), Expect = 2e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -1 Query: 366 MEHQVSFTQKKGKPLPKRGQIKAQIIGTLVRSLVPKSS 253 ME+Q KKGKPLP+RGQ+KA+I G+LVRS++P SS Sbjct: 1 MEYQRQPFGKKGKPLPRRGQVKARIFGSLVRSIIPSSS 38 >gb|PKU81228.1| hypothetical protein MA16_Dca026651 [Dendrobium catenatum] Length = 70 Score = 51.6 bits (122), Expect = 3e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = -1 Query: 366 MEHQVSFTQKKGKPLPKRGQIKAQIIGTLVRSLVPKSS 253 ME+Q +KKG PLP+RGQ+KA+I G+LVRS++P SS Sbjct: 1 MEYQKQPFEKKGNPLPRRGQVKAKIFGSLVRSILPSSS 38