BLASTX nr result
ID: Ophiopogon22_contig00023915
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00023915 (898 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMP00083.1| Glycoside hydrolase, family 28 [Corchorus olitorius] 59 7e-06 >gb|OMP00083.1| Glycoside hydrolase, family 28 [Corchorus olitorius] Length = 682 Score = 58.5 bits (140), Expect = 7e-06 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = -1 Query: 292 TKQITKDYIYQKWLIFTHVNGLVVNGSGTINVQGQIWWKRNCTSK 158 +K K Y +WL FTHVNGL++NGSGTIN +G WW + C K Sbjct: 379 SKSSWKGYPINRWLAFTHVNGLMINGSGTINGRGSAWWPQPCLHK 423