BLASTX nr result
ID: Ophiopogon22_contig00023792
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00023792 (382 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK69561.1| uncharacterized protein A4U43_C05F24270 [Asparagu... 54 3e-07 >gb|ONK69561.1| uncharacterized protein A4U43_C05F24270 [Asparagus officinalis] Length = 81 Score = 54.3 bits (129), Expect = 3e-07 Identities = 35/74 (47%), Positives = 40/74 (54%) Frame = -3 Query: 380 LSTSDQVXXXXXXXXXRVPASEPAGEHKLNKYLETKGRFXXXXXXXXXXXGLILNTDYHG 201 L TSD+V RV ASE AG+ ++ L+TK F LILN DYHG Sbjct: 11 LITSDEVFGRKLQEKTRVQASESAGKQQVQN-LDTKQGFGREEGDDIEG--LILNADYHG 67 Query: 200 VKTHPSLPPKHPRP 159 V THPS PKHPRP Sbjct: 68 VTTHPSPLPKHPRP 81