BLASTX nr result
ID: Ophiopogon22_contig00023767
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00023767 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245707.1| AT-hook motif nuclear-localized protein 10-l... 61 6e-08 >ref|XP_020245707.1| AT-hook motif nuclear-localized protein 10-like [Asparagus officinalis] gb|ONK80250.1| uncharacterized protein A4U43_C01F15550 [Asparagus officinalis] Length = 364 Score = 61.2 bits (147), Expect = 6e-08 Identities = 29/47 (61%), Positives = 32/47 (68%) Frame = -3 Query: 475 SESXXXXDPGSPAMSLSGSVRTYNNSNHHGQTMPAYNSISMWSHSGH 335 SES DPGSPAM+LS SV +NNS HGQ M Y SI W+HSGH Sbjct: 313 SESDDDDDPGSPAMNLSSSVGNFNNSGQHGQMMAGYGSIGGWTHSGH 359